BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30158 (742 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00048-11|AAB53833.1| 995|Caenorhabditis elegans Hypothetical p... 48 5e-06 AC084159-9|AAK39358.1| 569|Caenorhabditis elegans Hypothetical ... 31 0.86 Z93391-6|CAJ85753.1| 198|Caenorhabditis elegans Hypothetical pr... 29 2.6 U53140-1|AAA96101.1| 276|Caenorhabditis elegans Hypothetical pr... 29 3.5 AL032627-21|CAD66221.1| 289|Caenorhabditis elegans Hypothetical... 28 8.0 AL021448-3|CAA16275.1| 291|Caenorhabditis elegans Hypothetical ... 28 8.0 >U00048-11|AAB53833.1| 995|Caenorhabditis elegans Hypothetical protein C05D11.1 protein. Length = 995 Score = 48.4 bits (110), Expect = 5e-06 Identities = 20/46 (43%), Positives = 32/46 (69%) Frame = +3 Query: 255 YWLELLRKYFNEDVITIVGSPSIEMQEKMAEEEKRRIEDQRALLGE 392 YW++L+ KYF T++G P+ E+ +K+AEEE++RI Q LG+ Sbjct: 435 YWVQLVNKYFTAPSATVIGVPNEELVDKIAEEEEKRIAAQCEKLGK 480 >AC084159-9|AAK39358.1| 569|Caenorhabditis elegans Hypothetical protein Y73B3A.4 protein. Length = 569 Score = 31.1 bits (67), Expect = 0.86 Identities = 15/38 (39%), Positives = 25/38 (65%) Frame = +2 Query: 89 CRNNSGRARPALRLSRIRPSHSAASETLCTHRMNRISY 202 C NS R RP++RL ++ SH A+S T C+++ +I + Sbjct: 315 CSENSKR-RPSIRLIDLKNSHKASS-TFCSYKDRKIDF 350 >Z93391-6|CAJ85753.1| 198|Caenorhabditis elegans Hypothetical protein W04G5.2 protein. Length = 198 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = +3 Query: 249 VRYWLELLRKYFNED-VITIVGSPS 320 V WL++LR + NED VIT+VG+ S Sbjct: 99 VEQWLKVLRDHANEDIVITLVGNKS 123 >U53140-1|AAA96101.1| 276|Caenorhabditis elegans Hypothetical protein ZC266.2 protein. Length = 276 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -1 Query: 370 SSILRFSSSAIFSCISMLGEPTIVITSSLKYLRKSSNQYLTIL 242 SS+ +FSS+ + S + I+SS Y R QYL +L Sbjct: 136 SSLKKFSSANVTISKSRTSNGEVTISSSSSYSRSKRRQYLRVL 178 >AL032627-21|CAD66221.1| 289|Caenorhabditis elegans Hypothetical protein Y41C4A.19 protein. Length = 289 Score = 27.9 bits (59), Expect = 8.0 Identities = 25/94 (26%), Positives = 43/94 (45%), Gaps = 5/94 (5%) Frame = -1 Query: 367 SILRFSSSAIFS-CISMLGEPTIVITSSLKYLRKSSNQYLTILPLNLEDLFEDSYEI*NP 191 S + FS A+FS CI++ P ++ + + ++ N ++ + D+F + I Sbjct: 16 SAVTFSVVAVFSLCITL---P--MVYNYVHGIKSQINHQISFCKHSARDIFSEVNHIRAS 70 Query: 190 VHSVSTESLR----CSGMRWPDAA*PQGWPRSPG 101 ++ + R CSG P AA P G P PG Sbjct: 71 PNNATLREKRQAGDCSGCCLPGAAGPAGTPGKPG 104 >AL021448-3|CAA16275.1| 291|Caenorhabditis elegans Hypothetical protein Y2H9A.3 protein. Length = 291 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +3 Query: 69 GPFGETTAETTPGERGQP*G*AASGHR 149 GP G+ A PG+ GQP GHR Sbjct: 172 GPAGDAGAPGAPGQDGQPGAPGQDGHR 198 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,103,576 Number of Sequences: 27780 Number of extensions: 352749 Number of successful extensions: 1192 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1085 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1191 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1745954468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -