BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30157 (567 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP8B7.03c |rpl402|rpl4-2, rpl4|60S ribosomal protein L2|Schizo... 94 1e-20 SPBC1711.06 |rpl401|rpl4-1, rpl4|60S ribosomal protein L2|Schizo... 93 2e-20 SPBC577.12 |mug71||endoribonuclease |Schizosaccharomyces pombe|c... 26 3.4 SPAC23H4.02 |ppk9||serine/threonine protein kinase Ppk9 |Schizos... 25 5.9 SPCPB16A4.05c |||urease accessory protein UREG |Schizosaccharomy... 25 5.9 >SPBP8B7.03c |rpl402|rpl4-2, rpl4|60S ribosomal protein L2|Schizosaccharomyces pombe|chr 2|||Manual Length = 363 Score = 94.3 bits (224), Expect = 1e-20 Identities = 50/110 (45%), Positives = 60/110 (54%) Frame = +2 Query: 59 LSVARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAG 238 ++ ARP VS+YS K +V LPFVFKAPIRPDLV VH +++KN RQPY VS++AG Sbjct: 1 MAAARPTVSIYS-KDGSVSSETIALPFVFKAPIRPDLVRSVHTAVAKNKRQPYAVSEKAG 59 Query: 239 HQTSADHGVLDVLSPEFXXXXXXXXXXXXXXXXXTCVVGGRMFAPTKPWR 388 HQTSA+ GRMFAPTK WR Sbjct: 60 HQTSAESWGTGRALARIPRVGGGGTHRSGQAAFGNMCRSGRMFAPTKTWR 109 >SPBC1711.06 |rpl401|rpl4-1, rpl4|60S ribosomal protein L2|Schizosaccharomyces pombe|chr 2|||Manual Length = 363 Score = 93.5 bits (222), Expect = 2e-20 Identities = 49/110 (44%), Positives = 60/110 (54%) Frame = +2 Query: 59 LSVARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAG 238 ++ ARP VS+Y+ K +V LPFVFKAPIRPDLV VH +++KN RQPY VS++AG Sbjct: 1 MAAARPTVSIYN-KDGSVSSETLALPFVFKAPIRPDLVRSVHTAVAKNKRQPYAVSEKAG 59 Query: 239 HQTSADHGVLDVLSPEFXXXXXXXXXXXXXXXXXTCVVGGRMFAPTKPWR 388 HQTSA+ GRMFAPTK WR Sbjct: 60 HQTSAESWGTGRALARIPRVGGGGTHRSGQAAFGNMCRSGRMFAPTKTWR 109 >SPBC577.12 |mug71||endoribonuclease |Schizosaccharomyces pombe|chr 2|||Manual Length = 606 Score = 26.2 bits (55), Expect = 3.4 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -1 Query: 120 APCTVSLFSEYTDTKGRATDRLISLL 43 A C V ++SEYT G ++ L++L+ Sbjct: 490 ADCVVKIWSEYTKNTGESSPVLVALV 515 >SPAC23H4.02 |ppk9||serine/threonine protein kinase Ppk9 |Schizosaccharomyces pombe|chr 1|||Manual Length = 532 Score = 25.4 bits (53), Expect = 5.9 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 58 SIGSPTFSVGVLREE*DGAGCSQAPPVRVQGAHPSGP 168 SI SP+ SVG + + D + S + P+ + G P Sbjct: 312 SITSPSSSVGQIPQPTDHSALSPSKPMSISGTESPNP 348 >SPCPB16A4.05c |||urease accessory protein UREG |Schizosaccharomyces pombe|chr 3|||Manual Length = 286 Score = 25.4 bits (53), Expect = 5.9 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = -3 Query: 376 RGGEHTSTHDTCYRRHPDRTYEYHHHGHAEFGRQH 272 +GG STH T++Y HH H G H Sbjct: 8 KGGSDDSTHH--------HTHDYDHHNHDHHGHDH 34 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,369,685 Number of Sequences: 5004 Number of extensions: 49243 Number of successful extensions: 110 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 240047038 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -