BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30157 (567 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 86 2e-17 At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 84 7e-17 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 31 0.71 At3g48240.1 68416.m05264 octicosapeptide/Phox/Bem1p (PB1) domain... 30 1.2 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 29 1.6 At4g25610.1 68417.m03689 zinc finger (C2H2 type) family protein ... 29 2.9 At4g39480.1 68417.m05585 cytochrome P450 family protein contains... 28 3.8 At5g01010.1 68418.m00001 expressed protein 28 5.0 At3g12430.1 68416.m01548 expressed protein ; expression supporte... 28 5.0 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 28 5.0 At1g28080.1 68414.m03437 expressed protein 27 6.6 At5g50480.1 68418.m06252 CCAAT-box binding transcription factor ... 27 8.7 At3g25840.1 68416.m03219 protein kinase family protein contains ... 27 8.7 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 85.8 bits (203), Expect = 2e-17 Identities = 48/114 (42%), Positives = 60/114 (52%), Gaps = 2/114 (1%) Frame = +2 Query: 53 MSLSVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVS 226 M+ + ARPLV++ + + T Q + LP V AP+RPD+VN VH +S NSRQPY VS Sbjct: 1 MAAAAARPLVTIQTLDGDMSTDQSSTVVLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVS 60 Query: 227 KEAGHQTSADHGVLDVLSPEFXXXXXXXXXXXXXXXXXTCVVGGRMFAPTKPWR 388 K+AGHQTSA+ GGRMFAPTK WR Sbjct: 61 KKAGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWR 114 Score = 70.5 bits (165), Expect = 7e-13 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +1 Query: 256 SWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGWTYVRP 372 SWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRG P Sbjct: 71 SWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAP 109 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 83.8 bits (198), Expect = 7e-17 Identities = 48/111 (43%), Positives = 56/111 (50%), Gaps = 2/111 (1%) Frame = +2 Query: 62 SVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEA 235 + ARPLV+V + T Q LP V AP+RPD+VN VH +S NSRQPY VSK+A Sbjct: 5 AAARPLVTVQGLDGDMSTDQSTTVTLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKKA 64 Query: 236 GHQTSADHGVLDVLSPEFXXXXXXXXXXXXXXXXXTCVVGGRMFAPTKPWR 388 GHQTSA+ GGRMFAPTK WR Sbjct: 65 GHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWR 115 Score = 70.5 bits (165), Expect = 7e-13 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +1 Query: 256 SWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGWTYVRP 372 SWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRG P Sbjct: 72 SWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAP 110 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 30.7 bits (66), Expect = 0.71 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 Query: 373 GGEHTSTHDTCYRRHPDRTYEYHHHGHAEF 284 G H S H Y H Y Y +HGH +F Sbjct: 116 GAHHMSHHHGHYGHHHGHGYGYGYHGHGKF 145 >At3g48240.1 68416.m05264 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 180 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +2 Query: 392 LAPSRQTFRTKSGGGGKRLKKAPLRSVAVPGP 487 L+P +Q SGGGG K+P VA P P Sbjct: 108 LSPPKQMSPRSSGGGGDLSPKSPFSVVASPSP 139 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/49 (32%), Positives = 29/49 (59%) Frame = +2 Query: 77 LVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 223 LV +++ SE+++ PLPF K+P +PD++ H + NS+ C+ Sbjct: 351 LVYLHAALSESMR-LYPPLPFNHKSPAKPDVLPSGH-KVDANSKIVICI 397 >At4g25610.1 68417.m03689 zinc finger (C2H2 type) family protein contains Pfam profile: PF00096 zinc finger, C2H2 type Length = 586 Score = 28.7 bits (61), Expect = 2.9 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 1/82 (1%) Frame = +2 Query: 44 SSEMSLSVARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYC- 220 S + ++ + RP VS K+ TV G P P++ N H+S+ N+ + Sbjct: 467 SEQSTVKIWRP-VSSQGRKTSTVNGNTDKED-KRSNPTTPEVKNAHHISLQFNNHEAKAF 524 Query: 221 VSKEAGHQTSADHGVLDVLSPE 286 ++K TSA+H L VLS E Sbjct: 525 LAKRWKEATSAEHVTL-VLSQE 545 >At4g39480.1 68417.m05585 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 989 Score = 28.3 bits (60), Expect = 3.8 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 128 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 223 P+PF K+P +PD++ H + NSR +C+ Sbjct: 384 PVPFNHKSPAKPDVLPSGH-KVKANSRILFCL 414 Score = 27.5 bits (58), Expect = 6.6 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 128 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 223 P+PF K+P +PD++ H + NS+ +C+ Sbjct: 857 PVPFQHKSPTKPDVLPSGH-KVDANSKILFCL 887 >At5g01010.1 68418.m00001 expressed protein Length = 409 Score = 27.9 bits (59), Expect = 5.0 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -3 Query: 253 STGLVTSLLAHAVGLPRVLGHRNVNIIDQVR-TDGRLEHEREGLG 122 +TG+ +L+ + VG+P+VL ++ I Q+ DG +E +RE G Sbjct: 203 ATGVYKTLVKYLVGVPQVL----LDFIRQINDDDGPMEEQRERYG 243 >At3g12430.1 68416.m01548 expressed protein ; expression supported by MPSS Length = 238 Score = 27.9 bits (59), Expect = 5.0 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -2 Query: 131 GAWLHPAPSHSSLSTPTLKVGLPID--SFRYFSEAIPPKY 18 G W+H SH+ S+ L VG+ + Y+S + P +Y Sbjct: 38 GQWIHDVLSHNRFSSHPLVVGVGVQWTPSSYYSASSPVRY 77 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 27.9 bits (59), Expect = 5.0 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 268 GRAVARIPRVRGGGTHRSGQGAFG--NMCRGWTYVRPHEALAGVGTV 402 G + IP + GGGTHRSG + G GW + LAG+G V Sbjct: 116 GGGLRPIP-IYGGGTHRSGHHSSGGRETASGWLGL---SILAGLGLV 158 >At1g28080.1 68414.m03437 expressed protein Length = 291 Score = 27.5 bits (58), Expect = 6.6 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = +2 Query: 119 AAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQTSADHGVLD 271 ++KP + AP RP ++D V+ + NS C E G S++ VLD Sbjct: 179 SSKPWIPQYMAPFRPSSLSDRDVT-NNNSLSRSCCVDEGGAGPSSEFRVLD 228 >At5g50480.1 68418.m06252 CCAAT-box binding transcription factor Hap5a, putative GI:14577940 CCAAT-binding protein subunit HAP5 {Hypocrea jecorina} similar to Transcription factor GB:CAA74053 GI:2398533 from [Arabidopsis thaliana] similarity to transcription factor Hap5a similar to transcription factor Hap5a [Arabidopsis thaliana](GI:6523090) Length = 202 Score = 27.1 bits (57), Expect = 8.7 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 341 TCVVGGRMFAPTKPWRALAPSRQTFRTKSGGGG 439 T +VG M+AP++ W A A + +GG G Sbjct: 167 TPMVGSGMYAPSQAWPAAAGDGEDDAEDNGGNG 199 >At3g25840.1 68416.m03219 protein kinase family protein contains Pfam profile: PF00069 eukaryotic protein kinase domain Length = 935 Score = 27.1 bits (57), Expect = 8.7 Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = -3 Query: 361 TSTHDT--CYRRHPDRTYEYHHHGHAEFGRQHVQYPMISTGLVTSLLAHAVGLPRVLGH 191 +S+ DT +RH R +++HHH H + + + S G T +L P V+ + Sbjct: 19 SSSDDTEKASKRHKHRHHKHHHHRHRHHRDKKRENEIPSAGDETEILDVTPAAPIVVSN 77 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,251,238 Number of Sequences: 28952 Number of extensions: 315396 Number of successful extensions: 976 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 967 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1092379416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -