BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30156 (775 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 23 2.1 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 6.3 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 22 6.3 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 8.3 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.3 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.3 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 Query: 555 ENFKNRFGKICYSIKFTITKINVHLAVLSNF 463 + +FG + YSI + I V+LA+L F Sbjct: 104 QRIDKQFGLLGYSINYRRISIFVNLAILGVF 134 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 557 QSQYVRVFLSPIVPNWGHAEN 619 Q+Q R + +PIVP++ + N Sbjct: 84 QTQPARFYSTPIVPHFAYNHN 104 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -3 Query: 623 SNFRHAPSWGLWGKETLSHIGFGKILRTDLGK 528 +N+ + + T+SH FG L T GK Sbjct: 254 NNYPYYSNMDYLSSSTMSHSQFGNGLETSWGK 285 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 Query: 79 EVEPETIEVVDA 114 E+EPETIE DA Sbjct: 287 ELEPETIESQDA 298 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 Query: 79 EVEPETIEVVDA 114 E+EPETIE DA Sbjct: 520 ELEPETIESQDA 531 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 Query: 79 EVEPETIEVVDA 114 E+EPETIE DA Sbjct: 520 ELEPETIESQDA 531 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,617 Number of Sequences: 336 Number of extensions: 4296 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -