BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30152 (452 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0790 - 21214282-21214369,21214455-21214564,21215478-212155... 89 1e-18 08_01_0372 + 3286861-3286939,3287220-3287299,3289041-3289150,328... 89 1e-18 09_04_0106 - 14636773-14636863,14636948-14637057,14638107-146381... 88 3e-18 03_05_0642 - 26346260-26346367,26347902-26348162,26348542-263498... 29 2.3 08_02_1209 - 25311892-25312170,25312254-25312483,25313081-25313426 27 5.3 01_05_0589 + 23459847-23460344,23460493-23461296 27 5.3 12_02_0035 - 12563503-12564405,12564494-12565611,12565709-125662... 27 7.1 02_05_0798 - 31810579-31811516,31811646-31811666,31811715-31812225 27 7.1 04_04_1557 + 34411215-34411571,34411676-34411831 27 9.3 02_05_1325 - 35708046-35708207,35708297-35708374,35708466-357085... 27 9.3 >08_02_0790 - 21214282-21214369,21214455-21214564,21215478-21215557, 21215659-21215737 Length = 118 Score = 89.4 bits (212), Expect = 1e-18 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 2/76 (2%) Frame = +1 Query: 34 MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 213 MVQRLT+R+R SY TKSNQ R+V+TPGGRLVYQY KK P+C K++GI RPA Sbjct: 1 MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA 60 Query: 214 E--RSRLCYRKKTVKR 255 E RSRL ++TV R Sbjct: 61 EYKRSRLSRNRRTVNR 76 Score = 43.6 bits (98), Expect = 8e-05 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = +3 Query: 258 YGGVLCHKCVKQRIVRAFLIEEQKIVK 338 YGGVL V++RI+RAFL+EEQKIVK Sbjct: 78 YGGVLSGTAVRERIIRAFLVEEQKIVK 104 >08_01_0372 + 3286861-3286939,3287220-3287299,3289041-3289150, 3289224-3289311 Length = 118 Score = 89.4 bits (212), Expect = 1e-18 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 2/76 (2%) Frame = +1 Query: 34 MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 213 MVQRLT+R+R SY TKSNQ R+V+TPGGRLVYQY KK P+C K++GI RPA Sbjct: 1 MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA 60 Query: 214 E--RSRLCYRKKTVKR 255 E RSRL ++TV R Sbjct: 61 EYKRSRLSRNRRTVNR 76 Score = 43.6 bits (98), Expect = 8e-05 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = +3 Query: 258 YGGVLCHKCVKQRIVRAFLIEEQKIVK 338 YGGVL V++RI+RAFL+EEQKIVK Sbjct: 78 YGGVLSGTAVRERIIRAFLVEEQKIVK 104 >09_04_0106 - 14636773-14636863,14636948-14637057,14638107-14638186, 14638302-14638380 Length = 119 Score = 88.2 bits (209), Expect = 3e-18 Identities = 44/76 (57%), Positives = 54/76 (71%), Gaps = 2/76 (2%) Frame = +1 Query: 34 MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 213 MVQRLT+R+R SY TKSNQ R+V+TPGG+LVYQY KK P+C K++GI RPA Sbjct: 1 MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA 60 Query: 214 E--RSRLCYRKKTVKR 255 E RSRL ++TV R Sbjct: 61 EYKRSRLSRNRRTVNR 76 Score = 43.6 bits (98), Expect = 8e-05 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = +3 Query: 258 YGGVLCHKCVKQRIVRAFLIEEQKIVK 338 YGGVL V++RI+RAFL+EEQKIVK Sbjct: 78 YGGVLSGTAVRERIIRAFLVEEQKIVK 104 >03_05_0642 - 26346260-26346367,26347902-26348162,26348542-26349849, 26349960-26350178,26350241-26350300,26352159-26352215, 26352945-26353029,26353486-26353843,26353931-26355170 Length = 1231 Score = 28.7 bits (61), Expect = 2.3 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +1 Query: 67 SYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPAERS 222 S N NQ+R+V+ G + +KP+++ + KL+G RP R+ Sbjct: 1123 SNNQSQNQQRLVQVGGKQGAA--TQKPQRLSNARPAREKLKGDNAKRPGSRT 1172 >08_02_1209 - 25311892-25312170,25312254-25312483,25313081-25313426 Length = 284 Score = 27.5 bits (58), Expect = 5.3 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -3 Query: 174 ALTTPWDLLGLFDILINQAATRCPYYSSL 88 A+ + WD G D+LIN A R +S L Sbjct: 94 AVQSAWDAFGRIDVLINNAGLRGGVHSPL 122 >01_05_0589 + 23459847-23460344,23460493-23461296 Length = 433 Score = 27.5 bits (58), Expect = 5.3 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -1 Query: 227 RRERSAGLAGWIPRSLLLH*PHLGIFL 147 R +R + GW P+ L+L+ P +G+F+ Sbjct: 286 RGDRGRTIRGWAPQVLVLNHPAVGVFV 312 >12_02_0035 - 12563503-12564405,12564494-12565611,12565709-12566239, 12566337-12567153 Length = 1122 Score = 27.1 bits (57), Expect = 7.1 Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 7/74 (9%) Frame = +3 Query: 3 SLSPAVKKLENGAAAYIQATTVVQHKIKS-------KKNSKDTGWPLGLSVCQKAQEDPK 161 +L ++ + N A Y Q Q +K+ KK +DT L S+ +++ P Sbjct: 1045 TLKADIQGMLNDEAKYAQLRDAAQPVVKAFQVLYWKKKGYEDTLRSLRASLASRSKSQPA 1104 Query: 162 VWSVQEQTPWYPAS 203 WS Q++ P+S Sbjct: 1105 SWSQQDKDSSTPSS 1118 >02_05_0798 - 31810579-31811516,31811646-31811666,31811715-31812225 Length = 489 Score = 27.1 bits (57), Expect = 7.1 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -1 Query: 230 QRRERSAGLAGWIPRSLLLH*PHLGIFL 147 + +ER LA W P+ L+L P +G+FL Sbjct: 354 ETKERGV-LASWCPQELVLSHPSVGLFL 380 >04_04_1557 + 34411215-34411571,34411676-34411831 Length = 170 Score = 26.6 bits (56), Expect = 9.3 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +1 Query: 145 PKKIPRCGQCKSKLRGIQPARPAERSRLCYR 237 P +I RC + ++ ++P RP++ SRLC R Sbjct: 138 PNRISRCLEEGAEDFLLKPVRPSDVSRLCSR 168 >02_05_1325 - 35708046-35708207,35708297-35708374,35708466-35708512, 35708731-35708839 Length = 131 Score = 26.6 bits (56), Expect = 9.3 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +1 Query: 145 PKKIPRCGQCKSKLRGIQPARPAERSRLCYR 237 P +I RC + ++ I+P RP++ SRLC R Sbjct: 97 PTRIRRCLEEGAEDFLIKPVRPSDVSRLCNR 127 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,640,823 Number of Sequences: 37544 Number of extensions: 234759 Number of successful extensions: 522 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 522 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 883560296 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -