BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30143 (551 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 25 0.58 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 23 2.3 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 2.3 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 22 3.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 5.4 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 21 9.5 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 9.5 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 24.6 bits (51), Expect = 0.58 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -1 Query: 140 GHRWRDDGRQEIVRSKRQSEVLIAKAVRLVSQDEWQQR 27 GH W+ D +E VR++ Q L A + D+ ++R Sbjct: 117 GHEWQADVSEEAVRARMQD--LTEGAKNMTINDDLEKR 152 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 22.6 bits (46), Expect = 2.3 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -2 Query: 457 GSRSPGSDHGQH 422 G+RSPG DH ++ Sbjct: 14 GARSPGGDHSEN 25 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.6 bits (46), Expect = 2.3 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 17 SKNVSAAIHPGIPTEPPSRSGLRTGAYSGRSP 112 S NV AA HP + P + + S +SP Sbjct: 21 SMNVKAAEHPSLRGTPLAMLAAQCNKLSNKSP 52 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 22.2 bits (45), Expect = 3.1 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 461 KNERAVPITQTGPGPEEIKEPTAEAES 541 KN+ A +T+T P P I T+ + S Sbjct: 144 KNKSAPILTKTSPTPVSINNNTSTSSS 170 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 5.4 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 93 APVRSPDREGGSVGIPG*MA 34 AP++ P REG PG +A Sbjct: 436 APIKGPGREGFYTQNPGFLA 455 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 20.6 bits (41), Expect = 9.5 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -3 Query: 480 GTARSFFVAAGVLGAITVSTPSEDNRDS 397 G + V +GV+ + V E+N DS Sbjct: 64 GESEMMVVTSGVIPGVAVDFLGENNDDS 91 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 359 RYALPENCNPD 391 R A P NC+PD Sbjct: 712 RLARPANCSPD 722 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,825 Number of Sequences: 336 Number of extensions: 2271 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13621010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -