BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30136 (710 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF040657-2|AAB95050.2| 312|Caenorhabditis elegans Hypothetical ... 29 4.3 AL034365-6|CAA22263.1| 347|Caenorhabditis elegans Hypothetical ... 28 7.6 >AF040657-2|AAB95050.2| 312|Caenorhabditis elegans Hypothetical protein T20H9.1 protein. Length = 312 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/52 (25%), Positives = 26/52 (50%) Frame = -2 Query: 388 KFYIDASYPEGNFGRNQLLDGSISLSPLYPVPTIDLHVRIATVLHRVSPDFD 233 KFY + + + Q +DG++ + V ++LH + + +H + P FD Sbjct: 109 KFYSEKGFIDQAAWATQFIDGALKGNACVFVEKLELHKLLFSEIHSILPYFD 160 >AL034365-6|CAA22263.1| 347|Caenorhabditis elegans Hypothetical protein Y69E1A.6 protein. Length = 347 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 561 PTAPVLLTKIGPLGTVISLRLHRSSKPE 478 P +TK+GP ISLRL + S PE Sbjct: 319 PIISTQMTKVGPPSADISLRLKKLSAPE 346 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,670,563 Number of Sequences: 27780 Number of extensions: 367285 Number of successful extensions: 756 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 756 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1655655746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -