BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30132 (453 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23806| Best HMM Match : zf-CCHC (HMM E-Value=0.0069) 28 4.2 SB_38160| Best HMM Match : Toxin_29 (HMM E-Value=3.7) 27 7.3 SB_19263| Best HMM Match : TAP42 (HMM E-Value=0.25) 27 7.3 >SB_23806| Best HMM Match : zf-CCHC (HMM E-Value=0.0069) Length = 290 Score = 27.9 bits (59), Expect = 4.2 Identities = 14/58 (24%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = +2 Query: 116 EHGASSCIS-GKRGRRCCNIWHWGSVDSISGSRARFQLSGNSGRKHSPAAQAYYGNLV 286 EH A C + G C HW + + ++ + +GN+ ++ ++ Y NLV Sbjct: 139 EHDAQRCPAYGSLCNYCSKPNHWSKICRLKQKYSQIRPTGNANARNQQQHRSQYPNLV 196 >SB_38160| Best HMM Match : Toxin_29 (HMM E-Value=3.7) Length = 534 Score = 27.1 bits (57), Expect = 7.3 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -1 Query: 213 AREPL-MESTDPQCHILQHRRPRLPLMQLEAPCSFNFCSLRAI 88 +REP S PQ H+L +R L + ++ CS CS+ I Sbjct: 57 SREPFDSRSKLPQKHLLNSKRRALAIAKILLACSPEHCSMSFI 99 >SB_19263| Best HMM Match : TAP42 (HMM E-Value=0.25) Length = 303 Score = 27.1 bits (57), Expect = 7.3 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -1 Query: 408 PNKTEKVRSWSDVENG*CLASPHGVGATMAAA 313 P K +K R W D ++G C + +G T+AAA Sbjct: 167 PEKLQKARDWDDWKDGLCGVA---IGYTVAAA 195 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,778,161 Number of Sequences: 59808 Number of extensions: 267302 Number of successful extensions: 685 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 685 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 908427626 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -