BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30131 (616 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 28 0.072 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 25 0.38 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 6.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 6.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 6.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 6.2 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 27.9 bits (59), Expect = 0.072 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +1 Query: 100 FLAIFSLFTPFLSTYIIEFKQRNFVICVILLKKNRNENFANKRQA 234 F +F++ +L+T ++ Q FVI L K +NFA K Q+ Sbjct: 172 FFTVFNVAQCYLTTELVLMLQTRFVILNKQLTKITVKNFATKTQS 216 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 25.4 bits (53), Expect = 0.38 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +3 Query: 90 MRLVFSYIFFIYPF-FEYVYYRI*ATKFCYLCYIIKK 197 ++LVF + +FIY F Y+YY + Y + K Sbjct: 141 LQLVFVFCYFIYLFTVYYIYYSVHEASIINFGYTLAK 177 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 148 IEFKQRNFVICVILLKKNRN 207 I+F+ ++ + L+KKNRN Sbjct: 738 IDFQPSAVLLLIDLMKKNRN 757 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 148 IEFKQRNFVICVILLKKNRN 207 I+F+ ++ + L+KKNRN Sbjct: 738 IDFQPSAVLLLIDLMKKNRN 757 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 148 IEFKQRNFVICVILLKKNRN 207 I+F+ ++ + L+KKNRN Sbjct: 738 IDFQPSAVLLLIDLMKKNRN 757 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 148 IEFKQRNFVICVILLKKNRN 207 I+F+ ++ + L+KKNRN Sbjct: 738 IDFQPSAVLLLIDLMKKNRN 757 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,063 Number of Sequences: 336 Number of extensions: 2404 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15666150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -