BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30130 (569 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 24 4.0 AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. 23 9.3 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.8 bits (49), Expect = 4.0 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +2 Query: 182 LKPPFSTC*TSLHSHMVLLLSRY-MIWNYFCT 274 L+P F C T + H++ +L+ + +W CT Sbjct: 224 LQPDFQFCHTFAYYHIIAMLNGFCSLWFVNCT 255 >AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. Length = 441 Score = 22.6 bits (46), Expect = 9.3 Identities = 14/70 (20%), Positives = 27/70 (38%) Frame = -1 Query: 428 SDGQKVLETIGDGMRG*SNSWVSNSQRKSSYISNSSLELGTEILWFDVQNFRCKNSSRSY 249 +DG +L + G S+ +S + + ++ G LWFD + + Sbjct: 101 ADGANLLTIADERAIGESDVIMSFLNKANRHLPKIRHHRGGHRLWFDTAEIDAERDNNQL 160 Query: 248 TCLTTRPYEN 219 + R Y+N Sbjct: 161 LYASLRMYKN 170 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 578,915 Number of Sequences: 2352 Number of extensions: 11977 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -