BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30126 (751 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC019963-1|AAH19963.1| 827|Homo sapiens ANKRD17 protein protein. 30 7.7 AB014597-1|BAA31672.2| 2486|Homo sapiens KIAA0697 protein protein. 30 7.7 >BC019963-1|AAH19963.1| 827|Homo sapiens ANKRD17 protein protein. Length = 827 Score = 30.3 bits (65), Expect = 7.7 Identities = 19/63 (30%), Positives = 29/63 (46%) Frame = -1 Query: 436 PSLFEITSMFSVPLPFDPNSNL*PGTLNNIVRYCSNCLVSSQSCEYNSSSDQFLYAFQEN 257 P+ I FS PLPF P S L + + + +VSSQS + S + Y + Sbjct: 460 PANKPIAPNFSAPLPFGPFSTLFENSPTSAHAFWGGSVVSSQSTPESMLSGKSSYLPNSD 519 Query: 256 PVY 248 P++ Sbjct: 520 PLH 522 >AB014597-1|BAA31672.2| 2486|Homo sapiens KIAA0697 protein protein. Length = 2486 Score = 30.3 bits (65), Expect = 7.7 Identities = 19/63 (30%), Positives = 29/63 (46%) Frame = -1 Query: 436 PSLFEITSMFSVPLPFDPNSNL*PGTLNNIVRYCSNCLVSSQSCEYNSSSDQFLYAFQEN 257 P+ I FS PLPF P S L + + + +VSSQS + S + Y + Sbjct: 2119 PANKPIAPNFSAPLPFGPFSTLFENSPTSAHAFWGGSVVSSQSTPESMLSGKSSYLPNSD 2178 Query: 256 PVY 248 P++ Sbjct: 2179 PLH 2181 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,953,489 Number of Sequences: 237096 Number of extensions: 2551543 Number of successful extensions: 5949 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5813 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5949 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 9015132854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -