BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30125 (751 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 1.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 1.5 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 22 4.6 AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical pro... 22 4.6 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 659 LGEKFQLRELISCGPSNLNNPTWWVWRKKTI 751 L E FQ R + G ++ NNP+ +RKK++ Sbjct: 1390 LDEAFQ-RRVTQIGSTSSNNPSISAFRKKSL 1419 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 659 LGEKFQLRELISCGPSNLNNPTWWVWRKKTI 751 L E FQ R + G ++ NNP+ +RKK++ Sbjct: 1390 LDEAFQ-RRVTQIGSTSSNNPSISAFRKKSL 1419 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +1 Query: 355 PWYQPSFTEVRKVLQLFRLRQINNG 429 P QP+ R + R++Q+NNG Sbjct: 80 PQQQPASVARRNARERNRVKQVNNG 104 >AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical protein protein. Length = 102 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 556 LSLANPRLYTNSRTLF 509 LS A PRL N+RT+F Sbjct: 87 LSSAFPRLKRNARTIF 102 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,769 Number of Sequences: 336 Number of extensions: 3814 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -