BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30120 (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 26 1.3 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 25 3.0 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 25 3.0 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 25 3.0 DQ974172-1|ABJ52812.1| 409|Anopheles gambiae serpin 13 protein. 24 4.0 CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 24 5.3 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 7.0 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 23 9.2 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 23 9.2 AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 23 9.2 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 23 9.2 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 25.8 bits (54), Expect = 1.3 Identities = 20/60 (33%), Positives = 26/60 (43%), Gaps = 9/60 (15%) Frame = +1 Query: 502 IVGSNQCNSCRCNADG-YGICSDEACTEHIIEP----KK--ECAPKTMWKNE--CNTCWC 654 IV N C SC C+ G Y D + +P KK +CAP +E C+ C C Sbjct: 930 IVSGNGCESCNCDPIGSYNASCDTYSGDCFCKPGVVGKKCDKCAPAYYGFSEDGCHACDC 989 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/36 (33%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 257 ESNCHFCRCSDSGV--AECLRQDSCDQIIFTEPVRC 358 E CH C C SG ++C + C E RC Sbjct: 981 EDGCHACDCDPSGSKGSQCNQYGQCPCNDNVEGRRC 1016 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 136 VPGLHFRAPLSQCRAKTIKQIAIKHLISL 50 V +HFR+P + A ++ I I HL L Sbjct: 323 VLNIHFRSPQTHTMAPWVRTIFINHLPKL 351 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 24.6 bits (51), Expect = 3.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 282 HLQKWQLLSPRFPPGIPLPTAFLGRQTRH 196 HL +++P F PG LP F+ + H Sbjct: 857 HLPDLTVITPVFAPGEALPVFFVASRGHH 885 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 24.6 bits (51), Expect = 3.0 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +2 Query: 401 CLDNGLGLCSLDACRRSSTPKKFELIQGREC 493 C G +C + C R P ELI GR C Sbjct: 560 CSGRGQCVCGVCVCERRPNPD--ELIDGRYC 588 Score = 23.8 bits (49), Expect = 5.3 Identities = 12/45 (26%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = +1 Query: 472 ADPGQRMRS---GIVGSNQCNSCRCNADGYGICSDEACTEHIIEP 597 +DP R R+ G+ +C C C+ +G + + E ++EP Sbjct: 501 SDPEYRERADECSNAGTYKCGICECDGTYHGQRCECSAMESLLEP 545 >DQ974172-1|ABJ52812.1| 409|Anopheles gambiae serpin 13 protein. Length = 409 Score = 24.2 bits (50), Expect = 4.0 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 286 RAPAEVAVALPSVPARHSTSDCISWTADASSVVI 185 ++PA +VALPSV R S S DA+ + + Sbjct: 175 QSPASSSVALPSVSFRSGFSTGFSKALDATILAL 208 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 23.8 bits (49), Expect = 5.3 Identities = 18/55 (32%), Positives = 20/55 (36%) Frame = -1 Query: 581 SVQASSLQMPYPSALHLQLLHWFDPTIPERILCPGSAQTSWELTIFYRHPRSIGP 417 S + SS QM P L PT CP ELT FY H + P Sbjct: 264 SQRPSSSQMQRPKVQQLDTAA--APTNHHLYRCPACGNLFVELTNFYNHSCTKAP 316 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.4 bits (48), Expect = 7.0 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 392 CYNPSGRRCLADNAQVQ 342 CY+PS R+C + Q + Sbjct: 1447 CYSPSDRQCAEEREQAE 1463 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.0 bits (47), Expect = 9.2 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -1 Query: 443 YRHPRSIGPDRYLSRRKCYNPS 378 Y HP + PD +L R P+ Sbjct: 151 YPHPETFNPDNFLPERTQNRPT 172 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.0 bits (47), Expect = 9.2 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -1 Query: 443 YRHPRSIGPDRYLSRRKCYNPS 378 Y HP + PD +L R P+ Sbjct: 151 YPHPETFNPDNFLPERTQNRPT 172 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 23.0 bits (47), Expect = 9.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 138 EGPCAAEQESKDKPSQITTDDA 203 EG AAE+ +KD + DDA Sbjct: 366 EGEAAAEEAAKDDEDEDDEDDA 387 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 130 LAQKAHVQQSKNQKTNRVR*QQMTRLPS 213 L Q+AH QQ + Q+ R R ++ +PS Sbjct: 293 LRQQAHQQQQRQQQKVRPRPDKIEVVPS 320 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 859,372 Number of Sequences: 2352 Number of extensions: 20856 Number of successful extensions: 116 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 116 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -