BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30116 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 25 1.6 AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 24 3.7 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 23 6.4 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 25.4 bits (53), Expect = 1.6 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +2 Query: 434 FLVNLFTDFQKYSDIPKEWEPPAPQHSRC 520 F V L T YS+ EW+PPA S C Sbjct: 124 FEVTLATKATIYSEGLVEWKPPAIYKSSC 152 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 24.2 bits (50), Expect = 3.7 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 444 FTKNVCCLSNLQLFVAFTASAAFCGLLYSRK 352 F+ ++CC ++ VAFT F +LY K Sbjct: 197 FSSSLCCFLSVWFVVAFTVE-RFIAVLYPLK 226 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.4 bits (48), Expect = 6.4 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +2 Query: 440 VNLFTDFQKYSDIPKEWEPPAPQHSRCS 523 V L T Y++ W+PPA S CS Sbjct: 126 VTLMTKATVYNNGMVIWQPPAVYKSSCS 153 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 688,114 Number of Sequences: 2352 Number of extensions: 14770 Number of successful extensions: 20 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -