BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30111 (706 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 24 1.0 X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 22 4.2 U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 22 4.2 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 22 4.2 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 5.6 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 24.2 bits (50), Expect = 1.0 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = -1 Query: 376 LSDLRSLIDSVYSMEFKFKLRFGRTTR*LKFI 281 + + ++ +D Y M+ +F L F + +KFI Sbjct: 694 VEEAKTFVDRCYKMQEQFTLNFRNSDELIKFI 725 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = -3 Query: 641 GMAKRPFNTNITIVTGLKTWLKYYTPKIYKL 549 G+ P N N+ + + + W + Y P Y L Sbjct: 55 GVQISPPNENLVVTSSNRPWWERYQPVSYIL 85 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = -3 Query: 641 GMAKRPFNTNITIVTGLKTWLKYYTPKIYKL 549 G+ P N N+ + + + W + Y P Y L Sbjct: 56 GVQISPPNENLVVTSSNRPWWERYQPVSYIL 86 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = -3 Query: 641 GMAKRPFNTNITIVTGLKTWLKYYTPKIYKL 549 G+ P N N+ + + + W + Y P Y L Sbjct: 56 GVQISPPNENLVVTSSNRPWWERYQPVSYIL 86 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.8 bits (44), Expect = 5.6 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -2 Query: 456 KQREMTNLKSVKQINLLVIKMVKI 385 ++R NLKS+K++NL K+ I Sbjct: 132 ERRAFMNLKSLKRLNLKGNKIATI 155 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,784 Number of Sequences: 336 Number of extensions: 2976 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -