BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30111 (706 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC119.13c |prp31||U4/U6 x U5 tri-snRNP complex subunit Prp31|S... 26 6.0 SPAC26F1.08c |||conserved protein|Schizosaccharomyces pombe|chr ... 26 6.0 SPAC323.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 26 6.0 SPBC3D6.07 |gpi3||pig-A|Schizosaccharomyces pombe|chr 2|||Manual 25 8.0 >SPBC119.13c |prp31||U4/U6 x U5 tri-snRNP complex subunit Prp31|Schizosaccharomyces pombe|chr 2|||Manual Length = 518 Score = 25.8 bits (54), Expect = 6.0 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 697 VVEKFRPKPKKRRLELFQLEWPNGL 623 + ++ P KKRRLEL QLE NG+ Sbjct: 22 ITDELGPDAKKRRLEL-QLEEGNGI 45 >SPAC26F1.08c |||conserved protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 977 Score = 25.8 bits (54), Expect = 6.0 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = -3 Query: 638 MAKRPFNTNITIVTGLKTWLKYYTPKIYKLLQIK*GIYNIRDPF 507 + R TN+TI G K + KLLQ+ +N++ PF Sbjct: 765 LLSRNLYTNLTICEGYKKQISSLLVTARKLLQLVNMEFNLKGPF 808 >SPAC323.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 575 Score = 25.8 bits (54), Expect = 6.0 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +2 Query: 359 ASQVRKIAGILTIFITSKLICFTDLRLVISLCFYTML 469 +S V+ I GIL + +++++CF R+ + FY +L Sbjct: 84 SSFVKSIVGILEVDASNEILCFR--RICLLCVFYKLL 118 >SPBC3D6.07 |gpi3||pig-A|Schizosaccharomyces pombe|chr 2|||Manual Length = 456 Score = 25.4 bits (53), Expect = 8.0 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 254 FTISKLNLDNKFQLTRSSTKTKLK 325 F ISK N D LT KTK+K Sbjct: 425 FKISKQNFDESLVLTDPKKKTKIK 448 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,622,819 Number of Sequences: 5004 Number of extensions: 48456 Number of successful extensions: 111 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 111 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -