BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30109 (707 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U21319-1|AAC46673.2| 258|Caenorhabditis elegans Hypothetical pr... 30 1.9 Z81072-5|CAB03020.1| 591|Caenorhabditis elegans Hypothetical pr... 28 5.7 Z68219-8|CAD59155.1| 430|Caenorhabditis elegans Hypothetical pr... 28 7.5 Z68219-1|CAA92481.2| 387|Caenorhabditis elegans Hypothetical pr... 28 7.5 Z68216-7|CAD59147.1| 430|Caenorhabditis elegans Hypothetical pr... 28 7.5 >U21319-1|AAC46673.2| 258|Caenorhabditis elegans Hypothetical protein C30G12.4 protein. Length = 258 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +3 Query: 21 SYECCLVTFVYIGDTWTFSLVKYMNAFKFIINVIMLLVRFS 143 S+ECC +TF Y + L+ Y F II++++ V S Sbjct: 97 SFECCSLTFSYSYMMVSCKLLLYYGTFSSIISIVLSCVATS 137 >Z81072-5|CAB03020.1| 591|Caenorhabditis elegans Hypothetical protein F30A10.6 protein. Length = 591 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/42 (26%), Positives = 22/42 (52%) Frame = -2 Query: 193 IRYSAFTAHCDQREREYENLTRSIITLIINLKAFIYFTKLNV 68 I Y T H +++ Y L ++T ++++ F Y T L++ Sbjct: 103 IPYKKTTLHLTEKQIRYNRLFTDMLTHVLSIGGFYYSTTLDI 144 >Z68219-8|CAD59155.1| 430|Caenorhabditis elegans Hypothetical protein T05A1.1a protein. Length = 430 Score = 27.9 bits (59), Expect = 7.5 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = +1 Query: 445 LFRLCFGNLISCIYTIKLIYVLRVYKQ 525 + LC N++ C+ ++ + ++ VYKQ Sbjct: 108 ILNLCASNVLMCLTSLPITFITNVYKQ 134 >Z68219-1|CAA92481.2| 387|Caenorhabditis elegans Hypothetical protein T05A1.1b protein. Length = 387 Score = 27.9 bits (59), Expect = 7.5 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = +1 Query: 445 LFRLCFGNLISCIYTIKLIYVLRVYKQ 525 + LC N++ C+ ++ + ++ VYKQ Sbjct: 65 ILNLCASNVLMCLTSLPITFITNVYKQ 91 >Z68216-7|CAD59147.1| 430|Caenorhabditis elegans Hypothetical protein T05A1.1a protein. Length = 430 Score = 27.9 bits (59), Expect = 7.5 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = +1 Query: 445 LFRLCFGNLISCIYTIKLIYVLRVYKQ 525 + LC N++ C+ ++ + ++ VYKQ Sbjct: 108 ILNLCASNVLMCLTSLPITFITNVYKQ 134 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,134,971 Number of Sequences: 27780 Number of extensions: 271439 Number of successful extensions: 591 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 591 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1645110168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -