BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30106 (708 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 50 5e-08 AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 39 1e-04 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 39 1e-04 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 39 1e-04 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 39 1e-04 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 25 0.20 CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 24 5.4 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 50.4 bits (115), Expect = 5e-08 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = +1 Query: 82 MRECISVHVGQAGVQIGNACWE 147 MRECISVHVGQAGVQIGN CW+ Sbjct: 1 MRECISVHVGQAGVQIGNPCWD 22 Score = 33.9 bits (74), Expect = 0.005 Identities = 18/45 (40%), Positives = 22/45 (48%) Frame = +2 Query: 137 PAGSFTAWSTASSLMARCPQTRPSGVETILSTLSSARPERQARTP 271 P T WS AS+ RCP+TR S ST SS R + + P Sbjct: 19 PCWDCTVWSMASNRTVRCPRTRRSEAVMTRSTPSSPRLAQASTCP 63 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 39.1 bits (87), Expect = 1e-04 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +3 Query: 399 HYTIGKEIVDLVLDRIRKLADQCTGLQGF 485 HYT G E+VD VLD +RK + C LQGF Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGF 29 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 39.1 bits (87), Expect = 1e-04 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +3 Query: 399 HYTIGKEIVDLVLDRIRKLADQCTGLQGF 485 HYT G E+VD VLD +RK + C LQGF Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGF 29 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 39.1 bits (87), Expect = 1e-04 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +3 Query: 399 HYTIGKEIVDLVLDRIRKLADQCTGLQGF 485 HYT G E+VD VLD +RK + C LQGF Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGF 29 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 39.1 bits (87), Expect = 1e-04 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +3 Query: 399 HYTIGKEIVDLVLDRIRKLADQCTGLQGF 485 HYT G E+VD VLD +RK + C LQGF Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGF 29 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 25.0 bits (52), Expect(2) = 0.20 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +2 Query: 188 CPQTRPSGVETILSTLSSARPERQARTPCCLR 283 C RPS ++ ++ S RP+ A + C R Sbjct: 164 CGSARPSRIDVAFASPSICRPDLAANSATCWR 195 Score = 21.8 bits (44), Expect(2) = 0.20 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 131 VMPAGSFTAWSTASSLMARCPQTRPSGV 214 V+ AG F AW TA +T+P G+ Sbjct: 116 VLLAGDFNAWHTAWG----SERTKPKGI 139 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 479 RILIFHSFGGVPALGSLPY*WSVSPL 556 R+L+ S+ G +PY WSV+ L Sbjct: 444 RVLMLGSWPGAMHADDIPYLWSVTDL 469 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 812,495 Number of Sequences: 2352 Number of extensions: 18010 Number of successful extensions: 40 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -