BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30106 (708 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 2.8 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 23 3.7 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 3.7 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 3.7 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 3.7 AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 22 5.0 AB073997-1|BAC76401.1| 124|Apis mellifera preprotachykinin prot... 22 5.0 AB073996-1|BAC76400.1| 215|Apis mellifera preprotachykinin prot... 22 5.0 AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin prot... 22 5.0 AB264333-1|BAF44088.1| 36|Apis mellifera ecdysone-induced prot... 22 6.6 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 8.7 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 21 8.7 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 21 8.7 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 21 8.7 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +3 Query: 237 LQRDRSGKHVPRAVFVDLEPTVVDEVRTGTYRQL 338 L+ R+ H+ + D+EPTV RQL Sbjct: 234 LEERRAQSHLEAHCYFDIEPTVQQHQPVTVNRQL 267 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -3 Query: 145 PSRHYRSGLR 116 P RHYRSGL+ Sbjct: 139 PLRHYRSGLK 148 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -3 Query: 208 RWSCLWASGHQAGCRAPGSKAPSRHYR 128 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -3 Query: 208 RWSCLWASGHQAGCRAPGSKAPSRHYR 128 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -3 Query: 208 RWSCLWASGHQAGCRAPGSKAPSRHYR 128 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 22.2 bits (45), Expect = 5.0 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +1 Query: 613 GFQLAVVRGPKNSILNQPTKNPL 681 GFQ VRG KNSI+N KN L Sbjct: 60 GFQ--GVRGKKNSIIND-VKNEL 79 >AB073997-1|BAC76401.1| 124|Apis mellifera preprotachykinin protein. Length = 124 Score = 22.2 bits (45), Expect = 5.0 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +1 Query: 613 GFQLAVVRGPKNSILNQPTKNPL 681 GFQ VRG KNSI+N KN L Sbjct: 61 GFQ--GVRGKKNSIIND-VKNEL 80 >AB073996-1|BAC76400.1| 215|Apis mellifera preprotachykinin protein. Length = 215 Score = 22.2 bits (45), Expect = 5.0 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +1 Query: 613 GFQLAVVRGPKNSILNQPTKNPL 681 GFQ VRG KNSI+N KN L Sbjct: 60 GFQ--GVRGKKNSIIND-VKNEL 79 >AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin protein. Length = 301 Score = 22.2 bits (45), Expect = 5.0 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +1 Query: 613 GFQLAVVRGPKNSILNQPTKNPL 681 GFQ VRG KNSI+N KN L Sbjct: 60 GFQ--GVRGKKNSIIND-VKNEL 79 >AB264333-1|BAF44088.1| 36|Apis mellifera ecdysone-induced protein 75 protein. Length = 36 Score = 21.8 bits (44), Expect = 6.6 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 179 MARCPQTRPSGVETILSTLSSARPE 253 +A+ P + T+ ST+SSA+PE Sbjct: 7 VAQLPHHLSPNMPTMDSTVSSAKPE 31 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.4 bits (43), Expect = 8.7 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +3 Query: 489 SSTPSVEYRLWGHFP 533 S P Y +W HFP Sbjct: 105 SGLPPEIYYIWSHFP 119 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 8.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 190 PTDKTIGGGDDSFNTFFSETGAAST 264 PT+ TIGGG + + + + AA+T Sbjct: 279 PTEVTIGGGGTTSSRRTTGSRAAAT 303 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 8.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 190 PTDKTIGGGDDSFNTFFSETGAAST 264 PT+ TIGGG + + + + AA+T Sbjct: 279 PTEVTIGGGGTTSSRRTTGSRAAAT 303 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 8.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 190 PTDKTIGGGDDSFNTFFSETGAAST 264 PT+ TIGGG + + + + AA+T Sbjct: 279 PTEVTIGGGGTTSSRRTTGSRAAAT 303 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,405 Number of Sequences: 438 Number of extensions: 4859 Number of successful extensions: 18 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -