BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30104 (702 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyce... 27 2.6 SPCC1183.05c |lig4||DNA ligase Lig4|Schizosaccharomyces pombe|ch... 25 7.9 >SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 993 Score = 27.1 bits (57), Expect = 2.6 Identities = 15/63 (23%), Positives = 26/63 (41%), Gaps = 2/63 (3%) Frame = +2 Query: 236 LCFRNVGLSDWNFLPVIQPSVFDYSCVNGPFETMVG--NNGTMMAIRIVHSKLRKREEHS 409 L + N+ + N +P+ QP Y N P+ ++ NNG + + + S Sbjct: 853 LGYVNIAVRGGNIIPLQQPGYTTYESRNNPYSLLIAMDNNGFASGSLYIDDGISMQTNSS 912 Query: 410 ASV 418 SV Sbjct: 913 LSV 915 >SPCC1183.05c |lig4||DNA ligase Lig4|Schizosaccharomyces pombe|chr 3|||Manual Length = 923 Score = 25.4 bits (53), Expect = 7.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -1 Query: 276 KKFQSDSPTFLKHSSIHS 223 KKF D PTF K +S HS Sbjct: 659 KKFLYDEPTFKKEASPHS 676 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,556,903 Number of Sequences: 5004 Number of extensions: 45575 Number of successful extensions: 108 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 325165428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -