BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30104 (702 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3753| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_57402| Best HMM Match : DEAD (HMM E-Value=0.42) 29 3.6 SB_54543| Best HMM Match : ResIII (HMM E-Value=1.9) 29 3.6 SB_50794| Best HMM Match : Cys_knot (HMM E-Value=2.2) 29 3.6 SB_48939| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_37849| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_27946| Best HMM Match : DEAD (HMM E-Value=0.42) 29 3.6 SB_21910| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_9872| Best HMM Match : ResIII (HMM E-Value=0.36) 29 3.6 SB_5900| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_366| Best HMM Match : ResIII (HMM E-Value=0.28) 29 3.6 SB_56794| Best HMM Match : ResIII (HMM E-Value=0.63) 29 3.6 SB_48412| Best HMM Match : ResIII (HMM E-Value=0.19) 29 3.6 SB_48295| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_46041| Best HMM Match : LIM (HMM E-Value=1.5) 29 3.6 SB_42858| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_34841| Best HMM Match : ResIII (HMM E-Value=1.6) 29 3.6 SB_31820| Best HMM Match : CG-1 (HMM E-Value=2.4) 29 3.6 SB_27423| Best HMM Match : ResIII (HMM E-Value=0.56) 29 3.6 SB_27311| Best HMM Match : DEAD (HMM E-Value=0.17) 29 3.6 SB_15115| Best HMM Match : ResIII (HMM E-Value=0.24) 29 3.6 SB_13172| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_5505| Best HMM Match : ResIII (HMM E-Value=0.55) 29 3.6 SB_2121| Best HMM Match : ResIII (HMM E-Value=0.46) 29 3.6 SB_43554| Best HMM Match : LIM (HMM E-Value=0.91) 29 4.8 SB_22386| Best HMM Match : HLH (HMM E-Value=1.6e-13) 29 4.8 SB_53226| Best HMM Match : ResIII (HMM E-Value=0.45) 29 4.8 SB_55623| Best HMM Match : ResIII (HMM E-Value=0.17) 28 6.4 SB_15409| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_50789| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_54647| Best HMM Match : Phage_tail_S (HMM E-Value=2.4) 28 8.4 >SB_3753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 976 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+RY CEDCG ++ CG Sbjct: 704 SDYRYLCEDCGKPYSTCDCG 723 >SB_57402| Best HMM Match : DEAD (HMM E-Value=0.42) Length = 428 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 338 SDYRCLCEDCGNPYSTCDCG 357 >SB_54543| Best HMM Match : ResIII (HMM E-Value=1.9) Length = 521 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 273 SDYRCLCEDCGNPYSTCDCG 292 >SB_50794| Best HMM Match : Cys_knot (HMM E-Value=2.2) Length = 396 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 134 SDYRCLCEDCGNPYSTCDCG 153 >SB_48939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 590 SDYRCLCEDCGNPYSTCDCG 609 >SB_37849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1213 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 895 SDYRCLCEDCGNPYSTCDCG 914 >SB_27946| Best HMM Match : DEAD (HMM E-Value=0.42) Length = 751 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 433 SDYRCLCEDCGNPYSTCDCG 452 >SB_21910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 15 SDYRCLCEDCGNPYSTCDCG 34 >SB_9872| Best HMM Match : ResIII (HMM E-Value=0.36) Length = 624 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 338 SDYRCLCEDCGNPYSTCDCG 357 >SB_5900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1023 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 842 SDYRCLCEDCGNPYSTCDCG 861 >SB_366| Best HMM Match : ResIII (HMM E-Value=0.28) Length = 1104 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCG ++R CG Sbjct: 927 SDYRCLCEDCGKPYSRCDCG 946 >SB_56794| Best HMM Match : ResIII (HMM E-Value=0.63) Length = 532 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 226 SDYRCLCEDCGNPYSTCDCG 245 >SB_48412| Best HMM Match : ResIII (HMM E-Value=0.19) Length = 1390 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 1072 SDYRCLCEDCGNPYSTCDCG 1091 >SB_48295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1269 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 951 SDYRRLCEDCGNPYSTCDCG 970 >SB_46041| Best HMM Match : LIM (HMM E-Value=1.5) Length = 1236 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 918 SDYRRLCEDCGNPYSTCDCG 937 >SB_42858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 953 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 876 SDYRCLCEDCGNPYSTCDCG 895 >SB_34841| Best HMM Match : ResIII (HMM E-Value=1.6) Length = 949 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 871 SDYRCLCEDCGNPYSTCDCG 890 >SB_31820| Best HMM Match : CG-1 (HMM E-Value=2.4) Length = 992 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 784 SDYRCLCEDCGNPYSTCDCG 803 >SB_27423| Best HMM Match : ResIII (HMM E-Value=0.56) Length = 562 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 436 SDYRCLCEDCGNPYSTCDCG 455 >SB_27311| Best HMM Match : DEAD (HMM E-Value=0.17) Length = 1178 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 858 SDYRCLCEDCGNPYSTCDCG 877 >SB_15115| Best HMM Match : ResIII (HMM E-Value=0.24) Length = 1179 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 873 SDYRCLCEDCGNPYSTCDCG 892 >SB_13172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 599 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCG ++R CG Sbjct: 422 SDYRCLCEDCGKPYSRCDCG 441 >SB_5505| Best HMM Match : ResIII (HMM E-Value=0.55) Length = 1346 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 1027 SDYRCLCEDCGNPYSTCDCG 1046 >SB_2121| Best HMM Match : ResIII (HMM E-Value=0.46) Length = 1106 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 895 SDYRCLCEDCGNPYSTCDCG 914 >SB_43554| Best HMM Match : LIM (HMM E-Value=0.91) Length = 334 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 15 SDYRCLCEDCGNPYSTCGCG 34 >SB_22386| Best HMM Match : HLH (HMM E-Value=1.6e-13) Length = 470 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 6/49 (12%) Frame = -3 Query: 343 PNHCFKRSVNARIIENTGLDHG---QEVPIRQSNI---SKTQFNSLTAV 215 PN CF+ + ++++ N D +E+P R+SN+ SK Q N + V Sbjct: 287 PNSCFQENYLSKLLANNKYDKNRVEEELPTRKSNLPFNSKIQTNEVELV 335 >SB_53226| Best HMM Match : ResIII (HMM E-Value=0.45) Length = 880 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R CEDCGN ++ CG Sbjct: 797 SDYRCLCEDCGNPYSTCGCG 816 >SB_55623| Best HMM Match : ResIII (HMM E-Value=0.17) Length = 755 Score = 28.3 bits (60), Expect = 6.4 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCG 555 +D+R+ CEDCG ++ CG Sbjct: 474 SDYRFLCEDCGKPYSTWDCG 493 >SB_15409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 419 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 507 GGGNCHKGCWRNARGSG-CGAGAAWSTSAGC 418 G G C KGC +G G CG G + AGC Sbjct: 267 GCGTCGKGCGTCGKGCGTCGKGCG-TCGAGC 296 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 507 GGGNCHKGCWRNARGSG-CGAGAAWSTSAGC 418 G G C KGC + +G G CG G + GC Sbjct: 253 GWGTCGKGCRTSGKGCGTCGKGCG-TCGKGC 282 >SB_50789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 777 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -3 Query: 328 KRSVNARIIENTGLDHGQEVPIRQSNI 248 K VNA I E+ GLD G VPI +S + Sbjct: 477 KPCVNALIREDEGLDEGSTVPIVESPV 503 >SB_54647| Best HMM Match : Phage_tail_S (HMM E-Value=2.4) Length = 571 Score = 27.9 bits (59), Expect = 8.4 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 614 NDHRYSCEDCGNWHARLPCGC 552 +D+R CEDCG ++ C C Sbjct: 276 SDYRCLCEDCGKPYSTCDCNC 296 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,192,538 Number of Sequences: 59808 Number of extensions: 370008 Number of successful extensions: 1206 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 1157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1204 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -