BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30094 (751 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 25 3.3 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 25 3.3 AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 pr... 24 4.4 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 24 5.8 AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding pr... 24 5.8 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 24.6 bits (51), Expect = 3.3 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -2 Query: 708 PCFNAPNINPGYSNAS*LSCQFPPGIGS*VESLSPGEI 595 P F A + +PG + S + PGIG + L PG + Sbjct: 434 PMFTAQSTSPG-PDRSPATLTPSPGIGGPISPLDPGNV 470 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 24.6 bits (51), Expect = 3.3 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -3 Query: 464 QRISSHEISSPSIYLQKECHQ*AQECIEWC 375 ++ S HE+ ECH+ EC E C Sbjct: 447 KKSSDHEVMVQKNRNATECHEEGMECSEQC 476 >AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 protein. Length = 276 Score = 24.2 bits (50), Expect = 4.4 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -1 Query: 232 YDCQLI*VWRISLARICRTLVAAIMSIFSSPSV 134 + C L +W++ CR + A+ S PSV Sbjct: 4 FRCSLRRMWKLRFGYACRRVADAMRLCVSEPSV 36 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.8 bits (49), Expect = 5.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 501 RFSKFRKGCQTLPENFV 451 +F + R+GC TLP V Sbjct: 401 QFVRIRRGCNTLPNEMV 417 >AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding protein AgamOBP21 protein. Length = 131 Score = 23.8 bits (49), Expect = 5.8 Identities = 10/40 (25%), Positives = 18/40 (45%) Frame = +3 Query: 306 CLTRIPMPVPKSFSTS*RISARTTPFNTFLCSLMTFFLKI 425 C + +P+ F+T R+ T T C++ F K+ Sbjct: 31 CRAELGGELPEDFATKMRLGDLTLDSETAKCTIQCMFAKV 70 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 768,232 Number of Sequences: 2352 Number of extensions: 15197 Number of successful extensions: 63 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -