BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30091 (864 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 23 3.6 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 22 6.3 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 23.0 bits (47), Expect = 3.6 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 127 IYFDSVSIIFYPPLMAWVVSVSISRVLAERHYLLDS 234 + F ++ F P L+ V IS V+A RH L++ Sbjct: 199 VIFSAMGSFFLPMLVMLYVYGRISCVIASRHRNLEA 234 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 22.2 bits (45), Expect = 6.3 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +1 Query: 508 NHFYQTSRSHL*AYPISRSHVYTFGY 585 +HF ++ + + PI+RS + FGY Sbjct: 57 SHFIESGITAIWLSPINRSPMVDFGY 82 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,248 Number of Sequences: 438 Number of extensions: 4000 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27916710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -