BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30090 (801 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC800.13 |||histone H4 variant|Schizosaccharomyces pombe|chr 2... 26 7.2 SPAC19D5.06c |din1||Dhp1p-interacting protein Din1|Schizosacchar... 26 7.2 >SPBC800.13 |||histone H4 variant|Schizosaccharomyces pombe|chr 2|||Manual Length = 479 Score = 25.8 bits (54), Expect = 7.2 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 447 SSHRAHTPPTLHPQLRRTPRL 509 SS R HTP T + ++TPRL Sbjct: 95 SSERRHTPQTNSQKSQKTPRL 115 >SPAC19D5.06c |din1||Dhp1p-interacting protein Din1|Schizosaccharomyces pombe|chr 1|||Manual Length = 352 Score = 25.8 bits (54), Expect = 7.2 Identities = 12/48 (25%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = -1 Query: 591 EDTAELMVLENNRRCSVSYSGSDRLSNEGAEY--VATAGVAWAEYARD 454 + T+ ++++E R SY+ DR+ G ++ ++T W +RD Sbjct: 118 DPTSGIIMMEERTRSETSYANQDRMCYWGYKFEAISTLPEIWDACSRD 165 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,666,436 Number of Sequences: 5004 Number of extensions: 47638 Number of successful extensions: 112 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 388424860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -