BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30090 (801 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC131801-1|AAI31802.1| 567|Homo sapiens protein phosphatase 1, ... 32 2.8 AL121889-1|CAI19080.1| 567|Homo sapiens protein phosphatase 1, ... 32 2.8 AL031657-1|CAI20058.1| 567|Homo sapiens protein phosphatase 1, ... 32 2.8 AF362910-1|AAK52796.1| 567|Homo sapiens CAAX box protein TIMAP ... 32 2.8 AB209564-1|BAD92801.1| 593|Homo sapiens ATP-binding cassette, s... 32 2.8 AB020630-1|BAA74846.2| 578|Homo sapiens KIAA0823 protein protein. 32 2.8 >BC131801-1|AAI31802.1| 567|Homo sapiens protein phosphatase 1, regulatory (inhibitor) subunit 16B protein. Length = 567 Score = 31.9 bits (69), Expect = 2.8 Identities = 14/51 (27%), Positives = 31/51 (60%) Frame = -3 Query: 439 EQSMLRKMVIHERLWTSKKILRKQLEKWSWSQPEMRHKRTMVQRRTNMLGQ 287 E +L K+ ERL ++K +QL+KW+ + +++H++ +R+ + G+ Sbjct: 10 ELQLLEKVPTLERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGR 60 >AL121889-1|CAI19080.1| 567|Homo sapiens protein phosphatase 1, regulatory (inhibitor) subunit 16B protein. Length = 567 Score = 31.9 bits (69), Expect = 2.8 Identities = 14/51 (27%), Positives = 31/51 (60%) Frame = -3 Query: 439 EQSMLRKMVIHERLWTSKKILRKQLEKWSWSQPEMRHKRTMVQRRTNMLGQ 287 E +L K+ ERL ++K +QL+KW+ + +++H++ +R+ + G+ Sbjct: 10 ELQLLEKVPTLERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGR 60 >AL031657-1|CAI20058.1| 567|Homo sapiens protein phosphatase 1, regulatory (inhibitor) subunit 16B protein. Length = 567 Score = 31.9 bits (69), Expect = 2.8 Identities = 14/51 (27%), Positives = 31/51 (60%) Frame = -3 Query: 439 EQSMLRKMVIHERLWTSKKILRKQLEKWSWSQPEMRHKRTMVQRRTNMLGQ 287 E +L K+ ERL ++K +QL+KW+ + +++H++ +R+ + G+ Sbjct: 10 ELQLLEKVPTLERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGR 60 >AF362910-1|AAK52796.1| 567|Homo sapiens CAAX box protein TIMAP protein. Length = 567 Score = 31.9 bits (69), Expect = 2.8 Identities = 14/51 (27%), Positives = 31/51 (60%) Frame = -3 Query: 439 EQSMLRKMVIHERLWTSKKILRKQLEKWSWSQPEMRHKRTMVQRRTNMLGQ 287 E +L K+ ERL ++K +QL+KW+ + +++H++ +R+ + G+ Sbjct: 10 ELQLLEKVPTLERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGR 60 >AB209564-1|BAD92801.1| 593|Homo sapiens ATP-binding cassette, sub-family F, member 1 variant protein. Length = 593 Score = 31.9 bits (69), Expect = 2.8 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = -3 Query: 448 EHREQSMLRKMVIHERLWTSKKILRKQLEKWSWSQPEMRHKRTMVQRRTNM 296 EHRE+ L+K + +ER S K +S SQ EM ++ M++ +++ Sbjct: 2 EHREKKKLKKQMEYERQVASLKAANAAENDFSVSQAEMSSRQAMLENASDI 52 >AB020630-1|BAA74846.2| 578|Homo sapiens KIAA0823 protein protein. Length = 578 Score = 31.9 bits (69), Expect = 2.8 Identities = 14/51 (27%), Positives = 31/51 (60%) Frame = -3 Query: 439 EQSMLRKMVIHERLWTSKKILRKQLEKWSWSQPEMRHKRTMVQRRTNMLGQ 287 E +L K+ ERL ++K +QL+KW+ + +++H++ +R+ + G+ Sbjct: 21 ELQLLEKVPTLERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGR 71 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,563,624 Number of Sequences: 237096 Number of extensions: 2251872 Number of successful extensions: 5378 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5074 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5377 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9869080686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -