BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30090 (801 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 1.4 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 24 1.9 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 24 1.9 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 3.3 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 3.3 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.2 bits (50), Expect = 1.4 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = -3 Query: 640 LRKNHHGAVVTGVR*HRRYCRTDGLGEQPQVQRKLQRERSP 518 L+ +HH T V+ H R + +Q Q QR+ +R P Sbjct: 144 LQNHHHHLQSTAVQDHHRPYQQQQQQQQRQQQRQEERRLRP 184 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 23.8 bits (49), Expect = 1.9 Identities = 12/18 (66%), Positives = 12/18 (66%), Gaps = 2/18 (11%) Frame = -3 Query: 628 HHGAVVTGVR*HR--RYC 581 H G VVTGV HR RYC Sbjct: 515 HSGEVVTGVIGHRMPRYC 532 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 23.8 bits (49), Expect = 1.9 Identities = 12/18 (66%), Positives = 12/18 (66%), Gaps = 2/18 (11%) Frame = -3 Query: 628 HHGAVVTGVR*HR--RYC 581 H G VVTGV HR RYC Sbjct: 515 HSGEVVTGVIGHRMPRYC 532 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.0 bits (47), Expect = 3.3 Identities = 11/37 (29%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +3 Query: 474 TLH--PQLRRTPRLRC*GDRSRCSLRCTCGCSPRPSV 578 T+H P+++ TPR + + ++RC P P V Sbjct: 397 TIHTIPEVKVTPRFQAKRLKEEANIRCHVAGEPLPRV 433 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 23.0 bits (47), Expect = 3.3 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -1 Query: 675 LGRYSRGQR*SPSVRTTMGLLLQE*DDTEDTAEL 574 LGR G+ S T L+ +E +D EDT L Sbjct: 31 LGRDDGGKSRQSSFEVTSLLMREETEDAEDTQTL 64 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,860 Number of Sequences: 438 Number of extensions: 3846 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25367793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -