BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30089 (748 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 26 1.4 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 26 1.4 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 26 1.4 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 26 1.4 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 24 4.3 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 25.8 bits (54), Expect = 1.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 454 HHRQPQHKSRHQNKCHQ 504 HH+Q QH S HQ + Q Sbjct: 253 HHQQQQHPSSHQQQSQQ 269 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 448 SIHHRQPQHKSRHQNKCHQ 504 S H+QP H++ H + HQ Sbjct: 272 SSQHQQPTHQTHHHHHHHQ 290 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 25.8 bits (54), Expect = 1.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 454 HHRQPQHKSRHQNKCHQ 504 HH+Q QH S HQ + Q Sbjct: 253 HHQQQQHPSSHQQQSQQ 269 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 448 SIHHRQPQHKSRHQNKCHQ 504 S H+QP H++ H + HQ Sbjct: 272 SSQHQQPTHQTHHHHHHHQ 290 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 25.8 bits (54), Expect = 1.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 454 HHRQPQHKSRHQNKCHQ 504 HH+Q QH S HQ + Q Sbjct: 205 HHQQQQHPSSHQQQSQQ 221 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 448 SIHHRQPQHKSRHQNKCHQ 504 S H+QP H++ H + HQ Sbjct: 224 SSQHQQPTHQTHHHHHHHQ 242 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 25.8 bits (54), Expect = 1.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 454 HHRQPQHKSRHQNKCHQ 504 HH+Q QH S HQ + Q Sbjct: 253 HHQQQQHPSSHQQQSQQ 269 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 503 KNQQAQVSPQQGLHRRPRDQIRAPNYMPPQL 595 + QQ Q QQ ++ + Q + Y+PPQL Sbjct: 272 QRQQQQRPRQQQQQQQQQQQQQGERYVPPQL 302 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 567,586 Number of Sequences: 2352 Number of extensions: 9422 Number of successful extensions: 43 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -