BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30089 (748 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g30410.1 68415.m03704 tubulin folding cofactor A (KIESEL) ide... 65 4e-11 >At2g30410.1 68415.m03704 tubulin folding cofactor A (KIESEL) identical to cDNA tubulin folding cofactor A, GI:20514256, SP|O04350 Tubulin-specific chaperone A (Tubulin-folding cofactor A) (CFA) (TCP1-chaperonin cofactor A homolog) {Arabidopsis thaliana} Length = 113 Score = 65.3 bits (152), Expect = 4e-11 Identities = 32/79 (40%), Positives = 46/79 (58%) Frame = +1 Query: 22 IRQIKIKTGVVKRIXXXXXXXXXXXXLQKNRIQRIKDEGQDEHNIRKQEEVLQESLMMVP 201 IR +KIKT KRI + + +KD+G D +++++QE VL ES MM+P Sbjct: 4 IRNLKIKTSTCKRIVKELHSYEKEVEREAAKTADMKDKGADPYDLKQQENVLGESRMMIP 63 Query: 202 DCQRRLIKAYTDLKTTLEQ 258 DC +RL A DLK+TL + Sbjct: 64 DCHKRLESALADLKSTLAE 82 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,064,755 Number of Sequences: 28952 Number of extensions: 193105 Number of successful extensions: 569 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 568 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1653386488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -