BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30087 (823 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 24 6.5 AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding pr... 24 6.5 AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding pr... 23 8.6 AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding pr... 23 8.6 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 8.6 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 23 8.6 AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein p... 23 8.6 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 23.8 bits (49), Expect = 6.5 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 175 VKQRLIKVDGKVRTEPTYPTGFMRCCLIE 261 VKQ L K DGK+ E ++ C+ E Sbjct: 337 VKQTLQKYDGKLSYEAVSEMSYLEQCISE 365 >AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding protein protein. Length = 155 Score = 23.8 bits (49), Expect = 6.5 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +3 Query: 3 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 149 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 33 AQQSLTQADMDEIAKGMRKVCMSRPKISEEMANYPSQGIFPDDKEFKCY 81 >AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding protein AgamOBP6 protein. Length = 155 Score = 23.4 bits (48), Expect = 8.6 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +3 Query: 3 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 149 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 33 AQQSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDQEFKCY 81 >AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding protein AgamOBP18 protein. Length = 151 Score = 23.4 bits (48), Expect = 8.6 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +3 Query: 3 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 149 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 29 AQQSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDKEFKCY 77 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.4 bits (48), Expect = 8.6 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 426 ADGAAIMRYQVRNILRSGRHTLDFTQLVLS 337 AD AA +RY + + RH L + Q ++S Sbjct: 483 ADTAAELRYAKEHADKENRHFLQYAQDLIS 512 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 23.4 bits (48), Expect = 8.6 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 577 RDIPAPSTLCTSRTPRDTLRH 639 +D+P LC TP +RH Sbjct: 646 KDVPTRELLCELDTPSTAIRH 666 >AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein protein. Length = 455 Score = 23.4 bits (48), Expect = 8.6 Identities = 15/60 (25%), Positives = 22/60 (36%) Frame = -3 Query: 182 CFTIFRTSFPVKAYFRRFLRKITRGKHSRNLWGPVDGLGAYTPPSLSNIHALGAFKRFKC 3 C + + PV +R R + RG +R+ PVD A +A KC Sbjct: 373 CISSIMEAMPVSVDRQRCYRCLERGHLARDCQSPVDRQQACIRCGADGHYAKSCTSEIKC 432 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 979,617 Number of Sequences: 2352 Number of extensions: 23378 Number of successful extensions: 106 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 87318630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -