BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30085 (848 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0097 - 1171949-1172047,1172520-1172591,1172791-1172949,117... 30 2.7 12_01_0584 - 4762476-4762613,4763986-4764075,4765048-4765146,476... 29 6.2 05_05_0201 + 23206859-23206998,23207858-23207936,23208121-232082... 29 6.2 08_02_0259 - 14974526-14974572,14974670-14974742,14974829-149748... 28 8.2 06_03_0215 - 18080286-18080914,18080925-18080997 28 8.2 >10_01_0097 - 1171949-1172047,1172520-1172591,1172791-1172949, 1172998-1173381,1173478-1175253,1175329-1175452, 1176859-1177027,1177131-1177226,1177339-1177527, 1177965-1179303 Length = 1468 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 661 STES*ETRIMEAFQK-IQNGPGKLQGTTRLEQLGNDLGRKGDLTN 792 + E +T +M+ + + GP L+ T LE GN LG DL+N Sbjct: 182 AAEPSDTEMMDVPKDPVVRGPTGLESTKNLENKGNQLGDDSDLSN 226 >12_01_0584 - 4762476-4762613,4763986-4764075,4765048-4765146, 4766032-4766154,4766243-4766405,4767307-4767356, 4767826-4767942,4769477-4769683,4769763-4769900, 4771212-4771274,4771358-4771441,4771933-4772084, 4772219-4772357,4772814-4772924 Length = 557 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +2 Query: 581 PRDETAHYHPHAAFDENSSNISTSRIKVQRVERQE*WKLSKRSRMDQG 724 P ++ Y HA F + S + S +++ R ER+E + KR + D G Sbjct: 9 PEEDDQSYEEHADFSQ--SEHAESAVEIMRREREERRRKLKREQHDDG 54 >05_05_0201 + 23206859-23206998,23207858-23207936,23208121-23208219, 23208561-23208674,23208762-23208910,23209010-23209091, 23209170-23209255,23209520-23209750,23209830-23210727 Length = 625 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +1 Query: 349 PVTPKSESQLESDNEDRRTHLSKRKHLDSDDSDETYTPFAEQ 474 P+ P S +E D +D +++RK+ SDE + +Q Sbjct: 304 PIAPPSAPPVEEDEDDEFAQIARRKNKSVISSDEASSSAGDQ 345 >08_02_0259 - 14974526-14974572,14974670-14974742,14974829-14974891, 14975030-14975097,14975172-14975295,14976434-14976493, 14976744-14976806,14976902-14977942,14978027-14978093, 14978188-14978303,14978454-14978540,14978749-14978838, 14979128-14979214,14979366-14979428,14979509-14979566, 14980174-14980231,14980349-14980416,14980508-14980587, 14981084-14981147,14981321-14981392,14981517-14981576, 14982344-14982398,14982487-14982520,14983845-14983931, 14984036-14984122,14984211-14984408,14984509-14984639, 14984739-14984838 Length = 1066 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/60 (21%), Positives = 26/60 (43%) Frame = +1 Query: 304 SVVNIISPCKNNDYEPVTPKSESQLESDNEDRRTHLSKRKHLDSDDSDETYTPFAEQTSR 483 S +++ ++ND E +T S S + R H ++ D +D+ T + + R Sbjct: 94 STYKLLADEEDNDAETITSTSRQSSASTSSKSRKHFRRKAEDQDDGNDDDETKIKQDSGR 153 >06_03_0215 - 18080286-18080914,18080925-18080997 Length = 233 Score = 28.3 bits (60), Expect = 8.2 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +3 Query: 504 QISNQRNDPCT*GIATGWDQKKRPTPQETRQHTI 605 Q+ R P G A WD ++RP P + T+ Sbjct: 176 QVGPGRQPPAPAGAADAWDPRRRPPPAACTRSTV 209 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,487,784 Number of Sequences: 37544 Number of extensions: 439238 Number of successful extensions: 1379 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1316 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1376 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2362209084 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -