BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30085 (848 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146727-1|AAO12087.1| 139|Anopheles gambiae odorant-binding pr... 27 0.72 AY070234-1|AAL58538.1| 223|Anopheles gambiae glutathione S-tran... 25 3.8 DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. 24 6.7 >AY146727-1|AAO12087.1| 139|Anopheles gambiae odorant-binding protein AgamOBP20 protein. Length = 139 Score = 27.1 bits (57), Expect = 0.72 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +3 Query: 90 VMMQFYKKKECTSAKEDFPLT*EFVLQAGQLMRLALL 200 ++ F+ CT K+ FPL E ++++G+++R L Sbjct: 1 MLFVFFTLLSCTKKKKIFPLRKEQMMKSGEMIRSVCL 37 >AY070234-1|AAL58538.1| 223|Anopheles gambiae glutathione S-transferase E3 protein. Length = 223 Score = 24.6 bits (51), Expect = 3.8 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +2 Query: 173 WPADAISTPEVLSYVEQLEK 232 +PADA P VL+Y+++LE+ Sbjct: 177 FPADASKYPLVLAYLKRLEQ 196 >DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. Length = 511 Score = 23.8 bits (49), Expect = 6.7 Identities = 19/68 (27%), Positives = 31/68 (45%) Frame = +1 Query: 355 TPKSESQLESDNEDRRTHLSKRKHLDSDDSDETYTPFAEQTSRXL*KEKVKFPIKEMILA 534 TP S +++ + ++ + LS +K L DD E Q SR + F ++ A Sbjct: 211 TPDSIDRVDHEQPEKMS-LSLKK-LGLDDEQEVMQAVESQGSRRKFNVRRSFLTGDIASA 268 Query: 535 LEGSQQVG 558 L G+ VG Sbjct: 269 LSGNSLVG 276 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 854,678 Number of Sequences: 2352 Number of extensions: 16697 Number of successful extensions: 37 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90132318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -