BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30083 (851 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014297-2035|AAF55191.1| 162|Drosophila melanogaster CG14867-P... 31 2.7 BT011450-1|AAR99108.1| 228|Drosophila melanogaster RE41058p pro... 29 6.1 AY059446-1|AAL13352.1| 181|Drosophila melanogaster GH19563p pro... 29 6.1 AE014297-3699|AAN14035.1| 131|Drosophila melanogaster CG11791-P... 29 6.1 AE014297-3698|AAF56386.1| 181|Drosophila melanogaster CG11791-P... 29 6.1 >AE014297-2035|AAF55191.1| 162|Drosophila melanogaster CG14867-PA protein. Length = 162 Score = 30.7 bits (66), Expect = 2.7 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +1 Query: 172 IAVEAMKCKEENCEVGVVLERNSLIVLSLTRPSSASAGGIGTIPSSAGKS 321 +A+E ++C+E E+ L+ + + S S+GG TIP+SA S Sbjct: 82 VALENVRCEELQIELTSALKAKQASRSACSGMGSVSSGGGATIPTSASSS 131 >BT011450-1|AAR99108.1| 228|Drosophila melanogaster RE41058p protein. Length = 228 Score = 29.5 bits (63), Expect = 6.1 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +2 Query: 521 NERASFRSLRKNIRGRWKRLVKKK 592 ++++SF+ RK GR+KRLV +K Sbjct: 183 SDKSSFKGFRKQFSGRFKRLVTRK 206 >AY059446-1|AAL13352.1| 181|Drosophila melanogaster GH19563p protein. Length = 181 Score = 29.5 bits (63), Expect = 6.1 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +2 Query: 521 NERASFRSLRKNIRGRWKRLVKKK 592 ++++SF+ RK GR+KRLV +K Sbjct: 137 SDKSSFKGFRKQFSGRFKRLVTRK 160 >AE014297-3699|AAN14035.1| 131|Drosophila melanogaster CG11791-PB, isoform B protein. Length = 131 Score = 29.5 bits (63), Expect = 6.1 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +2 Query: 521 NERASFRSLRKNIRGRWKRLVKKK 592 ++++SF+ RK GR+KRLV +K Sbjct: 87 SDKSSFKGFRKQFSGRFKRLVTRK 110 >AE014297-3698|AAF56386.1| 181|Drosophila melanogaster CG11791-PA, isoform A protein. Length = 181 Score = 29.5 bits (63), Expect = 6.1 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +2 Query: 521 NERASFRSLRKNIRGRWKRLVKKK 592 ++++SF+ RK GR+KRLV +K Sbjct: 137 SDKSSFKGFRKQFSGRFKRLVTRK 160 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,287,386 Number of Sequences: 53049 Number of extensions: 648204 Number of successful extensions: 2065 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1966 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2058 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4085918148 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -