BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30083 (851 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024772-2|AAF60537.2| 756|Caenorhabditis elegans Osm-9 and cap... 29 5.5 AL132948-28|CAD31828.1| 263|Caenorhabditis elegans Hypothetical... 28 9.7 >AC024772-2|AAF60537.2| 756|Caenorhabditis elegans Osm-9 and capsaicin receptor-relatedprotein 4 protein. Length = 756 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -3 Query: 798 WI*ILLTTHLKFWFDVQRFKTQAPFEVSCFQ 706 WI I+L T LKF F + FK+ PF + ++ Sbjct: 508 WIVIVLLTSLKFLFFCRGFKSVGPFVLMLYK 538 >AL132948-28|CAD31828.1| 263|Caenorhabditis elegans Hypothetical protein Y39B6A.36 protein. Length = 263 Score = 27.9 bits (59), Expect = 9.7 Identities = 16/59 (27%), Positives = 29/59 (49%) Frame = -1 Query: 320 DLPALEGIVPIPPAEADDGLVNDSTMSELRSRTTPTSQFSSLHFIASTAMGAKSIEKRG 144 +L +G++ P E +G + ST+++ + PT LH + S M S +K+G Sbjct: 51 ELHTAKGLIHPKPKEPTEG--SSSTVTQPEASEIPTEYSFILHDVKSQTMSVLSEDKQG 107 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,227,082 Number of Sequences: 27780 Number of extensions: 318679 Number of successful extensions: 951 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 862 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 951 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2118983636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -