BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30082 (859 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 25 1.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 4.1 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 5.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 5.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 5.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 5.4 X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 22 7.1 U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 22 7.1 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 22 7.1 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 22 7.1 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 9.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 9.4 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 9.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 9.4 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 24.6 bits (51), Expect = 1.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -2 Query: 834 FPVGAHGQVLGPKRQTPGTS 775 F +G HG +L P TP S Sbjct: 49 FSMGGHGSLLSPSGNTPNKS 68 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/45 (22%), Positives = 20/45 (44%) Frame = +1 Query: 709 ANTLKGTGPNFHAFLKKGGSHFACTRGLPFWA*NLTVGPNRKNCL 843 A+ T H +++KG G+P + + ++ N +N L Sbjct: 2038 ADATFNTNFTIHYWIEKGADRRKLVMGMPMYGQSFSLADNNQNGL 2082 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +1 Query: 460 WSWSLWSASRCW 495 W W LW S+ W Sbjct: 465 WIWLLWLLSQTW 476 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +1 Query: 460 WSWSLWSASRCW 495 W W LW S+ W Sbjct: 465 WIWLLWLLSQTW 476 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +1 Query: 460 WSWSLWSASRCW 495 W W LW S+ W Sbjct: 465 WIWLLWLLSQTW 476 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +1 Query: 460 WSWSLWSASRCW 495 W W LW S+ W Sbjct: 465 WIWLLWLLSQTW 476 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +1 Query: 559 GGKPVRSRLSEGFGGLLRYKVGLS 630 GG+ + GFG ++ ++ GLS Sbjct: 245 GGEAISKHEYTGFGTVIEFQYGLS 268 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +1 Query: 559 GGKPVRSRLSEGFGGLLRYKVGLS 630 GG+ + GFG ++ ++ GLS Sbjct: 246 GGEAISKHEYTGFGTVIEFQYGLS 269 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +1 Query: 559 GGKPVRSRLSEGFGGLLRYKVGLS 630 GG+ + GFG ++ ++ GLS Sbjct: 246 GGEAISKHEYTGFGTVIEFQYGLS 269 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 21.8 bits (44), Expect = 7.1 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 425 LLLFRRQVENCFLVGGMRLQYVSL 354 LL+F +Q+ CF V +RL+ L Sbjct: 181 LLIFVQQIPFCFFVRVIRLKIEDL 204 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 9.4 Identities = 5/12 (41%), Positives = 7/12 (58%) Frame = +1 Query: 460 WSWSLWSASRCW 495 W W +W S+ W Sbjct: 219 WIWLVWLLSQAW 230 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 9.4 Identities = 5/12 (41%), Positives = 7/12 (58%) Frame = +1 Query: 460 WSWSLWSASRCW 495 W W +W S+ W Sbjct: 452 WIWLVWLLSQAW 463 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = +1 Query: 490 CWSGWPKLQVVWCHLRDHHGQEP 558 C + + + HLR H G++P Sbjct: 255 CGKSYARPSTLKTHLRTHSGEKP 277 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 9.4 Identities = 5/12 (41%), Positives = 7/12 (58%) Frame = +1 Query: 460 WSWSLWSASRCW 495 W W +W S+ W Sbjct: 452 WIWLVWLLSQAW 463 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,371 Number of Sequences: 336 Number of extensions: 4795 Number of successful extensions: 22 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23763101 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -