BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30082 (859 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 25 0.68 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 25 1.2 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 25 1.2 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 25.4 bits (53), Expect = 0.68 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 636 DAASTDRGNSTNLITDNSTDLFKLGKHFEGNGAK 737 +A T+ G ST L TD +++ + H++ +GAK Sbjct: 58 NALRTELGASTKLATDTTSENEENYPHYQMSGAK 91 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 24.6 bits (51), Expect = 1.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 127 LVDVSYGGENGFNQAIELAAESL 195 ++D SYGG GF A+ L ++ L Sbjct: 660 IIDHSYGGGFGFGSAVLLISDRL 682 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 24.6 bits (51), Expect = 1.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 127 LVDVSYGGENGFNQAIELAAESL 195 ++D SYGG GF A+ L ++ L Sbjct: 698 IIDHSYGGGFGFGSAVLLISDRL 720 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 260,891 Number of Sequences: 438 Number of extensions: 6240 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27673956 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -