BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30081 (757 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 23 2.6 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 3.5 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 401 GLEQEFASLDGDCFEYEDK 457 G+ E L G C+EY+D+ Sbjct: 280 GVHSESQKLVGVCYEYQDR 298 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.6 bits (46), Expect = 3.5 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -3 Query: 584 SSTEYLLFSGPAHSPQLPRPTSIPPSWIFVL-PSGTYTVCIHILCLH 447 S T L+ + P H+PQ+ ++ S F L P + IH +H Sbjct: 1386 SVTHQLIVNAPPHAPQIALTSTTTNSLTFKLKPHESDVEPIHGYTIH 1432 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,886 Number of Sequences: 336 Number of extensions: 4241 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -