BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30079 (872 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13885.1 68417.m02151 3'-5' exonuclease-related contains weak... 29 3.1 At5g16210.1 68418.m01894 HEAT repeat-containing protein contains... 29 4.1 >At4g13885.1 68417.m02151 3'-5' exonuclease-related contains weak similarity to Pfam domain PF01612: 3'-5' exonuclease Length = 263 Score = 29.5 bits (63), Expect = 3.1 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 325 FRLHRCPPGEGCSAGDSC 272 + L RC PGEGC+ D C Sbjct: 167 WELFRCSPGEGCNCPDMC 184 >At5g16210.1 68418.m01894 HEAT repeat-containing protein contains Pfam profile PF02985: HEAT repeat Length = 1180 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = -3 Query: 789 GSAGQLSICNKGVFQKARQLSRILLNPLIG---ATNLGSLSVQNPVI 658 G AG +S N G + +++S LL+P G +LGS+ +P I Sbjct: 381 GEAGNISYANNGTLENQKEVSNYLLSPSNGNFSPRDLGSILKVDPGI 427 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,779,473 Number of Sequences: 28952 Number of extensions: 302259 Number of successful extensions: 759 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 728 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 759 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2048424000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -