BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30076 (828 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42839-7|AAC69012.1| 1722|Caenorhabditis elegans Drosophila crum... 28 7.1 Z82262-1|CAB05151.2| 361|Caenorhabditis elegans Hypothetical pr... 28 9.4 >U42839-7|AAC69012.1| 1722|Caenorhabditis elegans Drosophila crumbs homolog protein 1 protein. Length = 1722 Score = 28.3 bits (60), Expect = 7.1 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +1 Query: 487 ISMQLYNSTDSQIVDATKITNCSLTKSRCYYSCIRKYDWYYNC 615 I Q NS + TK TNC + + + C++K D ++ C Sbjct: 1273 IVCQCGNSWMGDSCNVTKTTNCKDSPCQNFGQCMQKTDTFFEC 1315 >Z82262-1|CAB05151.2| 361|Caenorhabditis elegans Hypothetical protein C43F9.4 protein. Length = 361 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -2 Query: 461 VIECYPITVLVEPVAYDEGLDERTNP*TQPTEFLAGSSQWVAF 333 V+EC + + V + L + NP + +FL S+ W++F Sbjct: 156 VLECMSFRMTMALVRTTDVLTSKINPFPRVIQFLLSSAPWISF 198 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,645,451 Number of Sequences: 27780 Number of extensions: 254603 Number of successful extensions: 521 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 515 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 521 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2050970610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -