BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30068 (572 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.4 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 23 2.4 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 23 2.4 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 22 4.3 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 21 5.6 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 9.9 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 1.4 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Frame = -3 Query: 195 RHLRAVLLEPVDAEC-----PYGSREAENLRVDPRRTLGHGLARAG 73 RHLR L P+ PYG+ +E + DP+ + + R+G Sbjct: 536 RHLRGNELLPMQQSQNPPTKPYGTCRSEGIFSDPKNCAAYYVCRSG 581 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 159 HRQVQEELLADGERV 203 HR+VQEE+L + E V Sbjct: 317 HREVQEEILKEMEAV 331 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 159 HRQVQEELLADGERV 203 HR+VQEE+L + E V Sbjct: 317 HREVQEEILKEMEAV 331 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 278 ARSGRRGHGPCQGQRAL 328 A GRRG GP + +R L Sbjct: 325 AGGGRRGPGPARSRRHL 341 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 21.4 bits (43), Expect = 5.6 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +3 Query: 204 QPRPAQHVPAAH 239 +P+P+QH P H Sbjct: 100 EPQPSQHCPRKH 111 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 20.6 bits (41), Expect = 9.9 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 Query: 230 RGPRVPPPDGPISEGDARS 286 +G VPPP G G S Sbjct: 1107 KGTAVPPPSGSSGPGSTGS 1125 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,101 Number of Sequences: 336 Number of extensions: 2609 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14203976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -