BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30068 (572 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 2.1 X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor pro... 22 5.0 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 5.0 X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 21 6.6 X72576-1|CAA51168.1| 144|Apis mellifera Apidaecin precursor pro... 21 8.7 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 8.7 AF442148-1|AAL35349.1| 199|Apis mellifera apidaecin precursor p... 21 8.7 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.0 bits (47), Expect = 2.1 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -1 Query: 203 NPLAICEQFFLNLSMPNAR 147 NP+ E++FLNL++ N R Sbjct: 403 NPVKGFEEYFLNLTVENNR 421 >X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor protein. Length = 283 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -2 Query: 151 PVWLARSRKPASRSTPNAWPRSGPG 77 PV++++ R P R A P + PG Sbjct: 102 PVYISQPRPPHPRLRREAEPEAEPG 126 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -2 Query: 151 PVWLARSRKPASRSTPNAWPRSGPG 77 PV++++ R P R A P + PG Sbjct: 158 PVYISQPRPPHPRLRREAEPEAEPG 182 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 151 PVWLARSRKPASRSTPNAWPRSGPG 77 PV++ + R P R A P + PG Sbjct: 46 PVYIPQPRPPHPRLRREAEPEAEPG 70 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 151 PVWLARSRKPASRSTPNAWPRSGPG 77 PV++ + R P R A P + PG Sbjct: 186 PVYIPQPRPPHPRLRREAEPEAEPG 210 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 151 PVWLARSRKPASRSTPNAWPRSGPG 77 PV++ + R P R A P + PG Sbjct: 214 PVYIPQPRPPHPRLRREAEPEAEPG 238 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 151 PVWLARSRKPASRSTPNAWPRSGPG 77 PV++ + R P R A P + PG Sbjct: 242 PVYIPQPRPPHPRLRREAKPEAKPG 266 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.8 bits (44), Expect = 5.0 Identities = 10/39 (25%), Positives = 20/39 (51%) Frame = +1 Query: 436 FTIPMEIVNIICESLLNFTTTTFVVC*MLMIDGFLLCLW 552 FT + NI+ + +TT+V ++++ L+ LW Sbjct: 228 FTTDLLSYNILLRRHYSMNSTTYVTLTIVLMTMTLMTLW 266 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -2 Query: 151 PVWLARSRKPASRSTPNAWPRSGPG 77 P+++ + R P R A P++ PG Sbjct: 47 PIYIPQPRPPHPRLRREAEPKAEPG 71 >X72576-1|CAA51168.1| 144|Apis mellifera Apidaecin precursor protein. Length = 144 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 151 PVWLARSRKPASRSTPNAWPRSGPG 77 PV++ + R P R A P + PG Sbjct: 47 PVYIPQPRPPHPRLRREAEPEAEPG 71 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 151 PVWLARSRKPASRSTPNAWPRSGPG 77 PV++ + R P R A P + PG Sbjct: 75 PVYIPQPRPPHPRLRREAEPEAEPG 99 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 151 PVWLARSRKPASRSTPNAWPRSGPG 77 PV++ + R P R A P + PG Sbjct: 103 PVYIPQPRPPHPRLRREAEPEAEPG 127 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +2 Query: 215 CTACTRGPRVPPP 253 C AC+ PR PP Sbjct: 389 CVACSPPPRQTPP 401 >AF442148-1|AAL35349.1| 199|Apis mellifera apidaecin precursor protein. Length = 199 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 151 PVWLARSRKPASRSTPNAWPRSGPG 77 PV++ + R P R A P + PG Sbjct: 18 PVYIPQPRPPHPRLRREAEPEAEPG 42 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 151 PVWLARSRKPASRSTPNAWPRSGPG 77 PV++ + R P R A P + PG Sbjct: 46 PVYIPQPRPPHPRLRREAEPEAEPG 70 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 151 PVWLARSRKPASRSTPNAWPRSGPG 77 PV++ + R P R A P + PG Sbjct: 74 PVYIPQPRPPHPRLRREAEPEAEPG 98 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 151 PVWLARSRKPASRSTPNAWPRSGPG 77 PV++ + R P R A P + PG Sbjct: 102 PVYIPQPRPPHPRLRREAEPEAEPG 126 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 151 PVWLARSRKPASRSTPNAWPRSGPG 77 PV++ + R P R A P + PG Sbjct: 130 PVYIPQPRPPHPRLRREAKPEAEPG 154 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 151 PVWLARSRKPASRSTPNAWPRSGPG 77 PV++ + R P R A P + PG Sbjct: 158 PVYIPQPRPPHPRLRREAEPEAEPG 182 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,591 Number of Sequences: 438 Number of extensions: 2968 Number of successful extensions: 21 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16504155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -