BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30064 (858 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |S... 27 3.4 SPAC24H6.01c ||SPAPB21F2.01|membrane bound O-acyltransferase, MB... 26 7.9 >SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 971 Score = 27.1 bits (57), Expect = 3.4 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = -2 Query: 731 FWWLENKFKLEPNVYTILHFIK 666 +W++++KFK P YT+ F + Sbjct: 178 YWYIQHKFKHIPGAYTVYAFFE 199 >SPAC24H6.01c ||SPAPB21F2.01|membrane bound O-acyltransferase, MBOAT |Schizosaccharomyces pombe|chr 1|||Manual Length = 588 Score = 25.8 bits (54), Expect = 7.9 Identities = 12/52 (23%), Positives = 21/52 (40%) Frame = -3 Query: 685 PYYTL*KNLGTMVNGFILIFSNIIQLQFILKARFNLLTKFIIRRPNSRILVF 530 PYY G +N + +I N+I + N+L F + + + F Sbjct: 504 PYYRYISGFGAALNIYFMIICNLIGFAVGIDGIKNVLVSFFLTLKGKKFIYF 555 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,375,003 Number of Sequences: 5004 Number of extensions: 69415 Number of successful extensions: 140 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 140 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 426466470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -