BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30064 (858 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ080903-1|AAY89549.1| 120|Anopheles gambiae olfactory receptor... 25 2.9 DQ080901-1|AAY89547.1| 120|Anopheles gambiae olfactory receptor... 25 2.9 DQ080897-1|AAY89543.1| 120|Anopheles gambiae olfactory receptor... 25 2.9 DQ080893-1|AAY89539.1| 120|Anopheles gambiae olfactory receptor... 25 2.9 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 25 3.9 DQ080908-1|AAY89554.1| 120|Anopheles gambiae olfactory receptor... 23 9.0 DQ080907-1|AAY89553.1| 120|Anopheles gambiae olfactory receptor... 23 9.0 DQ080906-1|AAY89552.1| 120|Anopheles gambiae olfactory receptor... 23 9.0 DQ080905-1|AAY89551.1| 120|Anopheles gambiae olfactory receptor... 23 9.0 DQ080904-1|AAY89550.1| 120|Anopheles gambiae olfactory receptor... 23 9.0 DQ080899-1|AAY89545.1| 120|Anopheles gambiae olfactory receptor... 23 9.0 DQ080898-1|AAY89544.1| 120|Anopheles gambiae olfactory receptor... 23 9.0 DQ080895-1|AAY89541.1| 120|Anopheles gambiae olfactory receptor... 23 9.0 DQ080894-1|AAY89540.1| 120|Anopheles gambiae olfactory receptor... 23 9.0 DQ080890-1|AAY89536.1| 120|Anopheles gambiae olfactory receptor... 23 9.0 DQ080889-1|AAY89535.1| 120|Anopheles gambiae olfactory receptor... 23 9.0 DQ080888-1|AAY89534.1| 120|Anopheles gambiae olfactory receptor... 23 9.0 DQ080886-1|AAY89532.1| 120|Anopheles gambiae olfactory receptor... 23 9.0 >DQ080903-1|AAY89549.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 25.0 bits (52), Expect = 2.9 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -2 Query: 728 WWLENKFKLEPNVYTILHFIK 666 W+L N+ K+E + +++H IK Sbjct: 99 WFLRNEHKIESALNSVVHLIK 119 >DQ080901-1|AAY89547.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 25.0 bits (52), Expect = 2.9 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -2 Query: 728 WWLENKFKLEPNVYTILHFIK 666 W+L N+ K+E + +++H IK Sbjct: 99 WFLRNEHKIESALNSVVHLIK 119 >DQ080897-1|AAY89543.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 25.0 bits (52), Expect = 2.9 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -2 Query: 728 WWLENKFKLEPNVYTILHFIK 666 W+L N+ K+E + +++H IK Sbjct: 99 WFLRNEHKIESALNSVVHLIK 119 >DQ080893-1|AAY89539.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 25.0 bits (52), Expect = 2.9 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -2 Query: 728 WWLENKFKLEPNVYTILHFIK 666 W+L N+ K+E + +++H IK Sbjct: 99 WFLRNEHKIESALNSVVHLIK 119 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 24.6 bits (51), Expect = 3.9 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = +2 Query: 203 RITFSLSNKKRLFRTHFRRYLIQLLYNVKDNSRCQFY 313 R+ FS +K+++ TH L+++V ++ FY Sbjct: 593 RVAFSRDQEKKVYVTHLLEQDSDLIWSVIGENKGHFY 629 >DQ080908-1|AAY89554.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 9.0 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = -2 Query: 728 WWLENKFKLEPNVYTILHFIK 666 W+L N+ K++ + +++H IK Sbjct: 99 WFLRNEHKIKSALNSVVHLIK 119 >DQ080907-1|AAY89553.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 9.0 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = -2 Query: 728 WWLENKFKLEPNVYTILHFIK 666 W+L N+ K++ + +++H IK Sbjct: 99 WFLRNEHKIKSALNSVVHLIK 119 >DQ080906-1|AAY89552.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 9.0 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = -2 Query: 728 WWLENKFKLEPNVYTILHFIK 666 W+L N+ K++ + +++H IK Sbjct: 99 WFLRNEHKIKSALNSVVHLIK 119 >DQ080905-1|AAY89551.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 9.0 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = -2 Query: 728 WWLENKFKLEPNVYTILHFIK 666 W+L N+ K++ + +++H IK Sbjct: 99 WFLRNEHKIKSALNSVVHLIK 119 >DQ080904-1|AAY89550.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 9.0 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = -2 Query: 728 WWLENKFKLEPNVYTILHFIK 666 W+L N+ K++ + +++H IK Sbjct: 99 WFLRNEHKIKSALNSVVHLIK 119 >DQ080899-1|AAY89545.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 9.0 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = -2 Query: 728 WWLENKFKLEPNVYTILHFIK 666 W+L N+ K++ + +++H IK Sbjct: 99 WFLRNEHKIKSALNSVVHLIK 119 >DQ080898-1|AAY89544.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 9.0 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = -2 Query: 728 WWLENKFKLEPNVYTILHFIK 666 W+L N+ K++ + +++H IK Sbjct: 99 WFLRNEHKIKSALNSVVHLIK 119 >DQ080895-1|AAY89541.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 9.0 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = -2 Query: 728 WWLENKFKLEPNVYTILHFIK 666 W+L N+ K++ + +++H IK Sbjct: 99 WFLRNEHKIKSALNSVVHLIK 119 >DQ080894-1|AAY89540.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 9.0 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = -2 Query: 728 WWLENKFKLEPNVYTILHFIK 666 W+L N+ K++ + +++H IK Sbjct: 99 WFLRNEHKIKSALNSVVHLIK 119 >DQ080890-1|AAY89536.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 9.0 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = -2 Query: 728 WWLENKFKLEPNVYTILHFIK 666 W+L N+ K++ + +++H IK Sbjct: 99 WFLRNEHKIKSALNSVVHLIK 119 >DQ080889-1|AAY89535.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 9.0 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = -2 Query: 728 WWLENKFKLEPNVYTILHFIK 666 W+L N+ K++ + +++H IK Sbjct: 99 WFLRNEHKIKSALNSVVHLIK 119 >DQ080888-1|AAY89534.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 9.0 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = -2 Query: 728 WWLENKFKLEPNVYTILHFIK 666 W+L N+ K++ + +++H IK Sbjct: 99 WFLRNEHKIKSALNSVVHLIK 119 >DQ080886-1|AAY89532.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 23.4 bits (48), Expect = 9.0 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = -2 Query: 728 WWLENKFKLEPNVYTILHFIK 666 W+L N+ K++ + +++H IK Sbjct: 99 WFLRNEHKIKSALNSVVHLIK 119 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 818,904 Number of Sequences: 2352 Number of extensions: 17613 Number of successful extensions: 68 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 91372671 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -