BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30049 (727 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 2e-24 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 9e-24 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 85 7e-17 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 61 8e-10 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 61 8e-10 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 52 4e-07 SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) 51 8e-07 SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 48 6e-06 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 47 1e-05 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 47 2e-05 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 46 3e-05 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 45 7e-05 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 44 2e-04 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 41 9e-04 SB_3229| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 40 0.002 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 39 0.004 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 38 0.008 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 38 0.008 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.058 SB_57086| Best HMM Match : PT (HMM E-Value=2.4) 30 1.7 SB_17696| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_9084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_5942| Best HMM Match : Sec7 (HMM E-Value=3.1e-09) 29 3.8 SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_34297| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_26341| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 28 6.7 SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) 28 6.7 SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_33220| Best HMM Match : TP2 (HMM E-Value=1.7) 28 6.7 SB_22331| Best HMM Match : fn3 (HMM E-Value=7.1e-14) 28 6.7 SB_15811| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 28 6.7 SB_43963| Best HMM Match : Ammonium_transp (HMM E-Value=0) 28 8.9 SB_5106| Best HMM Match : F5_F8_type_C (HMM E-Value=3.6e-31) 28 8.9 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 109 bits (263), Expect = 2e-24 Identities = 49/67 (73%), Positives = 61/67 (91%) Frame = +2 Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433 KTATFSIS+LQ IDT +RE QAL+L+PTRELA QIQKVV+ALGD+++ +CHACIGGTN+ Sbjct: 47 KTATFSISVLQAIDTQLREPQALVLSPTRELANQIQKVVLALGDYMSVQCHACIGGTNIG 106 Query: 434 EDIRQLE 454 EDIR+L+ Sbjct: 107 EDIRKLD 113 Score = 60.9 bits (141), Expect = 1e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 162 GFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257 GFEKPSAIQQRAI P ++GRDVIAQAQSGTGK Sbjct: 16 GFEKPSAIQQRAIKPILKGRDVIAQAQSGTGK 47 Score = 32.3 bits (70), Expect = 0.41 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = +1 Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567 GRV+DMI +IK+ VLDEADE Sbjct: 124 GRVFDMIRRRNLRTRSIKMLVLDEADE 150 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 107 bits (257), Expect = 9e-24 Identities = 52/73 (71%), Positives = 63/73 (86%), Gaps = 6/73 (8%) Frame = +2 Query: 254 KTATFSISILQQIDTSIRE------CQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415 KTATF+ISILQ+IDT+ ++ CQAL+LAPTRELAQQIQKVV+ALGD+++ KCHACI Sbjct: 135 KTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQIQKVVLALGDYMHVKCHACI 194 Query: 416 GGTNVREDIRQLE 454 GGTNVRED +LE Sbjct: 195 GGTNVREDRMKLE 207 Score = 90.2 bits (214), Expect = 1e-18 Identities = 51/84 (60%), Positives = 55/84 (65%), Gaps = 22/84 (26%) Frame = +3 Query: 72 GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQ------------ 215 G ++WD+VVE+FDDMNLKE LLRGIYAYGFEKPSAIQQRAI PC Q Sbjct: 52 GKRQSNWDEVVESFDDMNLKEALLRGIYAYGFEKPSAIQQRAIRPCCQEFSPSHVCYNQL 111 Query: 216 ----------GRDVIAQAQSGTGK 257 RDVIAQAQSGTGK Sbjct: 112 NLTKNHYVLSARDVIAQAQSGTGK 135 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/27 (62%), Positives = 19/27 (70%) Frame = +1 Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567 GRV+DMI + IKLFVLDEADE Sbjct: 218 GRVFDMINRGVLNTRDIKLFVLDEADE 244 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 84.6 bits (200), Expect = 7e-17 Identities = 36/51 (70%), Positives = 47/51 (92%) Frame = +2 Query: 302 IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454 +RE QAL+L+PTRELA QIQKVV+ALGD+++ +CHACIGGTN+ EDIR+L+ Sbjct: 1 LREPQALVLSPTRELANQIQKVVLALGDYMSVQCHACIGGTNIGEDIRKLD 51 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 61.3 bits (142), Expect = 8e-10 Identities = 28/66 (42%), Positives = 44/66 (66%) Frame = +2 Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433 KTA + + +L++ DT+ QAL+L PTRELA Q ++ I LG H+ A+ GGT+++ Sbjct: 97 KTAAYLVPLLERTDTTKNCIQALVLVPTRELALQTSQICIELGKHMGAQVMVTTGGTSLK 156 Query: 434 EDIRQL 451 +DI +L Sbjct: 157 DDILRL 162 Score = 59.7 bits (138), Expect = 2e-09 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = +3 Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257 F+D LK ELL GI+ GF+KPS IQ+ +I + GRD++A+A++GTGK Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGK 97 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 61.3 bits (142), Expect = 8e-10 Identities = 28/66 (42%), Positives = 44/66 (66%) Frame = +2 Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433 KTA + + +L++ DT+ QAL+L PTRELA Q ++ I LG H+ A+ GGT+++ Sbjct: 97 KTAAYLVPLLERTDTTKNCIQALVLVPTRELALQTSQICIELGKHMGAQVMVTTGGTSLK 156 Query: 434 EDIRQL 451 +DI +L Sbjct: 157 DDILRL 162 Score = 59.7 bits (138), Expect = 2e-09 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = +3 Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257 F+D LK ELL GI+ GF+KPS IQ+ +I + GRD++A+A++GTGK Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGK 97 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 52.4 bits (120), Expect = 4e-07 Identities = 26/68 (38%), Positives = 40/68 (58%), Gaps = 1/68 (1%) Frame = +2 Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430 KT FS+ L+ + T Q +IL PTRE+A Q++ V+ A+G H + C IGG ++ Sbjct: 63 KTCVFSVIALENVITESNCIQIIILTPTREIAVQVKDVICAIGCHYDGLACKVFIGGISL 122 Query: 431 REDIRQLE 454 ED + L+ Sbjct: 123 EEDKKALK 130 Score = 49.2 bits (112), Expect = 3e-06 Identities = 27/49 (55%), Positives = 32/49 (65%) Frame = +3 Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257 F + L LLRG+ GFEKPS IQ +AI G D+IAQA+SGTGK Sbjct: 15 FHSLLLSPTLLRGLNEAGFEKPSPIQLKAIPLGRCGLDLIAQAKSGTGK 63 >SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) Length = 475 Score = 51.2 bits (117), Expect = 8e-07 Identities = 26/49 (53%), Positives = 29/49 (59%) Frame = +3 Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257 F D LK ELLR I GFE PS +Q I I G D+I QA+SG GK Sbjct: 49 FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDIICQAKSGMGK 97 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 1/68 (1%) Frame = +2 Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430 KTA F ++ LQQ++ + L++ TRELA QI K ++ N K GG N+ Sbjct: 97 KTAVFVLATLQQLEPVDGQVSVLVMCHTRELAFQIHKEYERFCKYMSNIKIAVFFGGINI 156 Query: 431 REDIRQLE 454 ++D + L+ Sbjct: 157 KKDQQTLK 164 >SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 51.2 bits (117), Expect = 8e-07 Identities = 26/49 (53%), Positives = 29/49 (59%) Frame = +3 Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257 F D LK ELLR I GFE PS +Q I I G D+I QA+SG GK Sbjct: 49 FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDIICQAKSGMGK 97 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 1/68 (1%) Frame = +2 Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430 KTA F ++ LQQ++ + L++ TRELA QI K ++ N K GG N+ Sbjct: 97 KTAVFVLATLQQLEPVDGQVSVLVMCHTRELAFQIHKEYERFCKYMSNIKIAVFFGGINI 156 Query: 431 REDIRQLE 454 ++D + L+ Sbjct: 157 KKDQQTLK 164 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 48.4 bits (110), Expect = 6e-06 Identities = 25/59 (42%), Positives = 35/59 (59%) Frame = +2 Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 430 KT F++ ILQ + + + ALIL PTRELA QI + ALG + KC +GG ++ Sbjct: 14 KTGAFALPILQALLDNPQRLFALILTPTRELAFQISEQCEALGSGIGVKCAVIVGGIDM 72 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 47.2 bits (107), Expect = 1e-05 Identities = 26/80 (32%), Positives = 44/80 (55%), Gaps = 2/80 (2%) Frame = +3 Query: 30 RIKVVTMDLREWTLG-HLH-TDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIM 203 R+ +D W G H+ D + +E+F D+NL EL + F+ P+ IQ +++ Sbjct: 45 RLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKNFQVPTPIQMQSLS 104 Query: 204 PCIQGRDVIAQAQSGTGKLL 263 + GRD+I A++G+GK L Sbjct: 105 CVMSGRDIIGLAETGSGKTL 124 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 46.8 bits (106), Expect = 2e-05 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 2/53 (3%) Frame = +3 Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDV--IAQAQSGTGK 257 ++F+++ L L RG+Y GF KPS IQ+ A+ + V IAQ+QSGTGK Sbjct: 103 KSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLADPPVNMIAQSQSGTGK 155 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/45 (42%), Positives = 29/45 (64%) Frame = +2 Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDH 388 KTA F +++L ++D + Q + L+PT ELA+Q KV A+G H Sbjct: 155 KTAAFVLTMLSRVDATKPYPQVICLSPTYELARQTGKVAEAMGKH 199 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 46.0 bits (104), Expect = 3e-05 Identities = 22/57 (38%), Positives = 33/57 (57%) Frame = +3 Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272 VE F D + + L G+ GF P+ IQ++ I + GRDV+ A++G+GK L L Sbjct: 49 VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVLGAAKTGSGKTLAFL 105 Score = 37.9 bits (84), Expect = 0.008 Identities = 22/70 (31%), Positives = 41/70 (58%), Gaps = 4/70 (5%) Frame = +2 Query: 254 KTATFSISILQ----QIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421 KT F I I++ Q TS+ AL+++PTRELA Q +V++ +G+ + IGG Sbjct: 100 KTLAFLIPIIETLWRQKWTSMDGLGALVISPTRELAYQTFEVLVKIGNKHDLSAGLIIGG 159 Query: 422 TNVREDIRQL 451 +++ + +++ Sbjct: 160 KDLKNEQKRI 169 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/52 (38%), Positives = 34/52 (65%) Frame = +3 Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257 + +F++ NL E L + ++KP+ +Q+ +I I GRDV+A AQ+G+GK Sbjct: 710 INSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQTGSGK 761 Score = 35.1 bits (77), Expect = 0.058 Identities = 18/47 (38%), Positives = 24/47 (51%) Frame = +2 Query: 314 QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454 QA+ +APTRELA QI + C GG +V +RQL+ Sbjct: 790 QAMCIAPTRELANQIYLEARKFAHGTMLRPVVCYGGVSVSHQLRQLQ 836 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/52 (38%), Positives = 34/52 (65%) Frame = +3 Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257 + +F++ NL E L + ++KP+ +Q+ +I I GRDV+A AQ+G+GK Sbjct: 133 INSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQTGSGK 184 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 44.0 bits (99), Expect = 1e-04 Identities = 25/61 (40%), Positives = 35/61 (57%), Gaps = 2/61 (3%) Frame = +2 Query: 254 KTATFSISILQQIDTSIREC--QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427 KTA F I + +++ T + +ALIL+PTRELA Q QK + LG K +GG + Sbjct: 331 KTAAFLIPMFEKLQTHTAKVGIRALILSPTRELALQTQKFIKELGRFTGLKSSVILGGDS 390 Query: 428 V 430 V Sbjct: 391 V 391 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/50 (44%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +3 Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG-RDVIAQAQSGTGK 257 F+D++L E LL + G++KP+ +Q+ AI P ++G RD++A AQ+G+GK Sbjct: 877 FEDVDLGEILLHNVGLAGYKKPTPVQKYAI-PIVKGKRDLMACAQTGSGK 925 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/45 (44%), Positives = 27/45 (60%) Frame = +2 Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454 L+L PTRELAQQ+Q+V ++G H + GG IR+LE Sbjct: 136 LVLCPTRELAQQVQEVAYSVGKHCKLRSTCIYGGAPKGPQIRELE 180 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/50 (38%), Positives = 33/50 (66%) Frame = +3 Query: 123 NLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272 ++ E+ L+GI GF + IQ ++I P ++GRD++ A++G+GK L L Sbjct: 578 DVSEKTLQGIKDMGFTTMTEIQHKSIAPLLKGRDLLGAAKTGSGKTLAFL 627 Score = 28.3 bits (60), Expect = 6.7 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454 +I++PTREL+ Q V L H N +GG N + + +L+ Sbjct: 648 IIISPTRELSLQTYGVARDLLKHHNFTYGIIMGGVNRKAEAERLQ 692 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/52 (32%), Positives = 35/52 (67%) Frame = +3 Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257 + +F+++ E+L+ I G+ +P+ +Q+ A+ + GRD++A AQ+G+GK Sbjct: 478 ITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDLMACAQTGSGK 529 Score = 41.5 bits (93), Expect = 7e-04 Identities = 27/72 (37%), Positives = 35/72 (48%), Gaps = 5/72 (6%) Frame = +2 Query: 254 KTATFSISIL-----QQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 418 KTA + + +L Q ++ R AL +APTRELA+QI DH K C G Sbjct: 529 KTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQIYIEARKFSDHTPIKVCVCYG 588 Query: 419 GTNVREDIRQLE 454 G +V QLE Sbjct: 589 GVSVPYQASQLE 600 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 41.1 bits (92), Expect = 9e-04 Identities = 19/50 (38%), Positives = 30/50 (60%) Frame = +3 Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257 +F + L + L+ A G +KP+ IQ + P +QGRD I A++G+GK Sbjct: 8 SFAGLGLNKWLVSQCVAMGIKKPTEIQLNCVPPILQGRDCIGCAKTGSGK 57 Score = 39.1 bits (87), Expect = 0.004 Identities = 24/76 (31%), Positives = 37/76 (48%) Frame = +2 Query: 224 CYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKC 403 C + + KTA F++ ILQ++ A++L PTRELA QI LG + K Sbjct: 47 CIGCAKTGSGKTAAFALPILQKLCDDPYGIFAVVLTPTRELAFQIADQFKVLGRPIGLKE 106 Query: 404 HACIGGTNVREDIRQL 451 +GG ++ + L Sbjct: 107 AVIVGGLDMMKQALSL 122 >SB_3229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +2 Query: 389 LNAKCHACIGGTNVREDIRQLE 454 ++ KCHACIGGTNVRED +LE Sbjct: 1 MHVKCHACIGGTNVREDRMKLE 22 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/37 (51%), Positives = 26/37 (70%) Frame = +2 Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427 ALILAPTRELAQQI++ ++ G L + + IGG + Sbjct: 181 ALILAPTRELAQQIEEEILKFGRPLGIRTVSVIGGAD 217 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/52 (28%), Positives = 32/52 (61%) Frame = +3 Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257 + + + + + +L + G++ P+ IQ++AI +Q RD+I A++G+GK Sbjct: 100 IRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDIIGVAETGSGK 151 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/53 (33%), Positives = 30/53 (56%) Frame = +3 Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLS 269 F + E L + + +G+ P+ IQ + + + GRDV+ A +G+GKLL S Sbjct: 198 FFHCSFNESLSKNLSNHGYHSPTPIQMQVLPVLLSGRDVMVCASTGSGKLLPS 250 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/52 (34%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +3 Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPC-IQGRDVIAQAQSGTGKLL 263 ++ + + ++LR + GF KP+ IQ +I P + RD+I A++G+GK L Sbjct: 132 WEGLGVAPDILRALGDQGFSKPTPIQSLSIPPALLYHRDIIGAAETGSGKTL 183 Score = 34.3 bits (75), Expect = 0.10 Identities = 17/46 (36%), Positives = 27/46 (58%) Frame = +2 Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454 ALI+APTRELA Q++ ++ + + K A +GG + R L+ Sbjct: 221 ALIMAPTRELALQVKDHLVKAAKYTSVKVAAIVGGMAAPKQQRLLK 266 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 37.9 bits (84), Expect = 0.008 Identities = 20/55 (36%), Positives = 31/55 (56%) Frame = +3 Query: 93 DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257 D+V+ +D ++ + E R + GF P+ IQ I + G+DV A A +GTGK Sbjct: 7 DEVLNAYDSLDEEAED-RAVNELGFLHPTPIQASTIPVALMGKDVCACAATGTGK 60 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 37.9 bits (84), Expect = 0.008 Identities = 20/59 (33%), Positives = 32/59 (54%) Frame = +3 Query: 96 QVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272 Q V +F + L++++L+ + A +P+ IQ I I VI AQ+G+GK L L Sbjct: 375 QRVYSFAGLGLRDDVLKALDALNIHQPTVIQMVTIPKIIHRHHVICAAQTGSGKTLAYL 433 Score = 29.1 bits (62), Expect = 3.8 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 302 IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421 ++ +A I+ P RELA QI K +L H + IGG Sbjct: 453 LKRPRACIVVPARELATQILKTAKSLCHHARFRSVGLIGG 492 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 36.7 bits (81), Expect = 0.019 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = +2 Query: 305 RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454 R+ A+++ PTRELA QI + N +C GGT + E I +L+ Sbjct: 143 RDMIAIVMTPTRELAIQIHRECKKFCKPNNLRCVCVYGGTGISEQIAELK 192 Score = 35.9 bits (79), Expect = 0.033 Identities = 18/59 (30%), Positives = 35/59 (59%) Frame = +3 Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYR 278 V+T+ ++ ++L + +EKP+ IQ +AI + GRD+IA + T +L + ++R Sbjct: 104 VKTWAQTGVQLKILDVLKKNSYEKPTPIQAQAIPVIMSGRDMIAIVMTPTRELAIQIHR 162 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 35.1 bits (77), Expect = 0.058 Identities = 16/56 (28%), Positives = 31/56 (55%) Frame = +3 Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLY 275 +F E+++ I + +P+ IQ +A+ + GRD+I A++G+GK L+ Sbjct: 518 SFAHFGFDEQMMASIRKLEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAFLW 573 Score = 32.3 bits (70), Expect = 0.41 Identities = 19/45 (42%), Positives = 21/45 (46%) Frame = +2 Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454 LI APTREL QQI G N A GG N E + L+ Sbjct: 594 LICAPTRELCQQIYTEARRFGKAYNIHVVAVFGGGNKYEQSKALQ 638 >SB_57086| Best HMM Match : PT (HMM E-Value=2.4) Length = 226 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -3 Query: 497 YTRPWSAHHVHEH-HSPVGEYLHGHWCHQCKHGI*HSSDHQ 378 YT P++ + H + H +Y H + HQC H H HQ Sbjct: 175 YTHPYTHPYTHPYTHQYTHQYPH-QYTHQCTHQYTHQYTHQ 214 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -3 Query: 497 YTRPWSAHHVHEH-HSPVGEYLHGHWCHQCKHGI*HSSDHQELSP 366 YT ++ + H++ H +Y H + HQC H H H P Sbjct: 139 YTHQYTHQYTHQYTHQYTHQYTH-QYTHQCTHPYTHQYTHPYTHP 182 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -3 Query: 497 YTRPWSAHHVHEH-HSPVGEYLHGHWCHQCKHGI*HSSDHQ 378 YT ++ H+ H++ H +Y H + HQ H H HQ Sbjct: 2 YTHQYTHHYTHQYTHQYPHQYTH-QYTHQYPHQYPHQYTHQ 41 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = -3 Query: 497 YTRPWSAHHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQ 378 YT P++ + H++ +Y H + HQ H H HQ Sbjct: 74 YTHPYTHPYTHQY---THQYTHHQYTHQYTHQYPHQYPHQ 110 >SB_17696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +3 Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPC-IQGRDVIAQAQS 245 ++ + + ++LR + GF KP+ IQ +I P + RD+I A++ Sbjct: 74 WEGLGVAPDILRALGDQGFSKPTPIQSLSIPPALLYHRDIIGAAET 119 >SB_9084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -3 Query: 476 HHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQELS 369 HH H+HH ++ H H H +H H DH ++ Sbjct: 11 HHHHDHHHHDHQH-HDHQHHDHQHHDHHHHDHHHMT 45 >SB_5942| Best HMM Match : Sec7 (HMM E-Value=3.1e-09) Length = 304 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -3 Query: 509 IIISYTRPWSAHHVHEHHSPVGEYLHGHWCHQCKH 405 III T + HH H +H + + H HW H H Sbjct: 143 IIIIITIVIAIHHHHYYHHHLLHHHHHHWHHHHHH 177 >SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2851 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -3 Query: 488 PWSAHHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQELS-PPS 360 PW+ H +H +P G+Y +HG H++ E + PPS Sbjct: 479 PWNMQHPPQHRAPPGQYPPLGASPPVQHGRGHATGRGEFAGPPS 522 >SB_34297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 512 Score = 28.7 bits (61), Expect = 5.1 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +2 Query: 287 QIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415 Q D++++E IL ELA++IQK++ LN K AC+ Sbjct: 58 QGDSTLKEPVQKILIIGLELAKEIQKLIDEASSGLNIKHAACL 100 >SB_26341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 329 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -3 Query: 476 HHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQELSPP 363 HH+ H G HGH H+ +H HSS +Q +PP Sbjct: 272 HHLEPEHEEHGHGGHGHGDHEREH---HSSQNQ--APP 304 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 28.3 bits (60), Expect = 6.7 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 6/56 (10%) Frame = +2 Query: 254 KTATFSISILQQI-DTSI-----RECQALILAPTRELAQQIQKVVIALGDHLNAKC 403 KT +F++ +++++ D + R + L++APTRELA+Q+ L +L C Sbjct: 123 KTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTRELAKQVGNEFENLKSNLEVYC 178 >SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) Length = 694 Score = 28.3 bits (60), Expect = 6.7 Identities = 21/75 (28%), Positives = 30/75 (40%), Gaps = 8/75 (10%) Frame = -3 Query: 581 SGTTFSSASSRTKSLMVLA*KRTTII-------ISYTRPWSAH-HVHEHHSPVGEYLHGH 426 S TT ++ T +++++ TTII + Y R H H H HH + H H Sbjct: 172 SSTTIVVTTNNTITIIIITITSTTIITMPSPSIVIYRRHHQHHQHHHHHHHQHNHHHHHH 231 Query: 425 WCHQCKHGI*HSSDH 381 H H H H Sbjct: 232 NHHHHHHHHYHHYHH 246 >SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 736 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = -3 Query: 476 HHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDHQE 375 HH H HH + H H H H H HQ+ Sbjct: 258 HHHHHHHHQHNHHQHHHHHHHHHHN--HHHHHQQ 289 >SB_33220| Best HMM Match : TP2 (HMM E-Value=1.7) Length = 590 Score = 28.3 bits (60), Expect = 6.7 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -3 Query: 515 TTIIISYTRPWSAHHVHEHHSPVGE 441 T III T P + HH H HH P G+ Sbjct: 408 THIIIIIT-PLANHHSHHHHHPSGQ 431 >SB_22331| Best HMM Match : fn3 (HMM E-Value=7.1e-14) Length = 908 Score = 28.3 bits (60), Expect = 6.7 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = -2 Query: 597 WSLENLWNNIFISFIKNKKFDGVGMKAHDDYHII---YTTLECPPR 469 W +E LW+N F I ++ +G+ K D + ++ ++EC PR Sbjct: 69 WGVERLWSNTFELLIGDQS-NGLNPKCGDRHAVLPYDMISIECNPR 113 >SB_15811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -1 Query: 403 AFSIQVITKSYHHLLNLLGQLSCGSQDQSLTFTNACID 290 A ++Q +TK+Y HL+N+ G +++ T C D Sbjct: 201 AHALQTLTKAYRHLMNVTGN---RDKEEKANATEQCAD 235 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 28.3 bits (60), Expect = 6.7 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = -3 Query: 506 IISYTRPWSAHHVHEHHSPVGEYLHGHWCHQCKHGI*HSSDH 381 I + T P+ HH H H + H H H+ +H H H Sbjct: 300 ITTATPPYRYHHHHHHRHHHHHHHHHHQRHRHRHRHRHRHHH 341 >SB_43963| Best HMM Match : Ammonium_transp (HMM E-Value=0) Length = 730 Score = 27.9 bits (59), Expect = 8.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -3 Query: 515 TTIIISYTRPWSAHHVHEH 459 TTII++ ++P S HH H H Sbjct: 556 TTIIVTSSKPLSHHHHHHH 574 >SB_5106| Best HMM Match : F5_F8_type_C (HMM E-Value=3.6e-31) Length = 445 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = -2 Query: 597 WSLENLWNNIFISFIKNKKFDGVGMKAHDDYHII---YTTLECPPR 469 W +++LW+N F I ++ +G+ K D + ++ ++EC PR Sbjct: 224 WGIQHLWSNTFELLIGDQS-NGLNPKCGDRHAVLPYDMISIECNPR 268 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,070,063 Number of Sequences: 59808 Number of extensions: 560562 Number of successful extensions: 2322 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 2026 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2279 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -