BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30047 (794 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 pr... 25 2.7 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 24 6.2 >AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 25.0 bits (52), Expect = 2.7 Identities = 7/20 (35%), Positives = 16/20 (80%) Frame = +1 Query: 82 MASTATLIQPSGELWKKIRE 141 +++ T+I+P G+LW K+++ Sbjct: 473 LSNAHTVIKPQGDLWLKVKK 492 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.8 bits (49), Expect = 6.2 Identities = 19/92 (20%), Positives = 36/92 (39%), Gaps = 3/92 (3%) Frame = +1 Query: 25 NRITKQLVPNWIVTYCKSEMASTATLIQPSG--ELWKKIREELNEDVNTRAQDLAAIKEW 198 +R+ K+L + A+ A L+ + ++WKK+ ++ Q +E+ Sbjct: 52 SRMIKELYQQTEPKSHRPSYANKAVLLSSAKWEQMWKKVVSPAEKETEVLCQQEREFREY 111 Query: 199 LRK-QPHLPDEWEDACLMTFSEAVASPLRNVK 291 LR + WE+ + A LR K Sbjct: 112 LRNGSKKMTSTWENTVQNIRDKKEAERLRRDK 143 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 871,850 Number of Sequences: 2352 Number of extensions: 18942 Number of successful extensions: 26 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83576403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -