BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30047 (794 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81551-1|CAB04483.2| 335|Caenorhabditis elegans Hypothetical pr... 29 3.8 Z50863-2|CAA90737.1| 351|Caenorhabditis elegans Hypothetical pr... 28 8.9 >Z81551-1|CAB04483.2| 335|Caenorhabditis elegans Hypothetical protein F56A12.1 protein. Length = 335 Score = 29.1 bits (62), Expect = 3.8 Identities = 22/70 (31%), Positives = 35/70 (50%) Frame = -2 Query: 250 SSGTRLPTHLVDGVAFSATP*LQLSPVPWC*HPHSIPRGFSSTVPRKAESGSPLMPSHFC 71 S+ + P+H+ D + S P +LS P S+ S +V A SP +P+ C Sbjct: 36 SNSSTSPSHISDQFSSSGGPPYELSSHILT--PSSVIPTPSPSVA-SASISSPTIPAFGC 92 Query: 70 NMSQSSLEQV 41 MS+ S+EQ+ Sbjct: 93 TMSEYSMEQM 102 >Z50863-2|CAA90737.1| 351|Caenorhabditis elegans Hypothetical protein C14H10.4 protein. Length = 351 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 619 VLKKFFHLYTGSLSSETGRKYTFINASPP 705 V+ FFH + S +TG Y+FI PP Sbjct: 269 VVASFFHFFFSKFSWQTGWLYSFICFYPP 297 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,255,162 Number of Sequences: 27780 Number of extensions: 424602 Number of successful extensions: 1263 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1175 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1263 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1935274832 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -