BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30041 (747 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0YFQ3 Cluster: Twin-arginine translocation pathway sig... 35 2.4 UniRef50_Q58593 Cluster: Polyferredoxin protein vhuB; n=12; Meth... 33 7.5 >UniRef50_Q0YFQ3 Cluster: Twin-arginine translocation pathway signal precursor; n=4; Geobacter|Rep: Twin-arginine translocation pathway signal precursor - Geobacter sp. FRC-32 Length = 310 Score = 34.7 bits (76), Expect = 2.4 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -3 Query: 682 YSVTPDGAIFVNPSILPSCMRCVNVCEFIYKNKTYSS 572 Y+ T +GA+ NP I C C+ C F +YSS Sbjct: 124 YTKTKEGAVIYNPKICVGCRNCMIACPFNVPGYSYSS 160 >UniRef50_Q58593 Cluster: Polyferredoxin protein vhuB; n=12; Methanococcales|Rep: Polyferredoxin protein vhuB - Methanococcus jannaschii Length = 394 Score = 33.1 bits (72), Expect = 7.5 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = -3 Query: 733 IYRIKFYEF*AVCSGLIYSVTPDGAIFVNPSILPSCMRCVNVC 605 IY +K E VC G + V + I + P P+C CVN+C Sbjct: 211 IYCLKCVE---VCPGDMIKVDEENLIVIPPKSCPACKLCVNIC 250 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 742,197,035 Number of Sequences: 1657284 Number of extensions: 14578672 Number of successful extensions: 28004 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 27148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28003 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 61323318355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -