BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30036 (699 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) 103 1e-22 SB_22837| Best HMM Match : REJ (HMM E-Value=0.057) 33 0.22 SB_45038| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_21643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_50701| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_8499| Best HMM Match : DUF229 (HMM E-Value=0) 29 4.8 SB_59024| Best HMM Match : 7tm_1 (HMM E-Value=5.2e-19) 29 4.8 SB_46059| Best HMM Match : Astacin (HMM E-Value=2.8e-17) 29 4.8 >SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) Length = 147 Score = 103 bits (247), Expect = 1e-22 Identities = 49/81 (60%), Positives = 61/81 (75%) Frame = +1 Query: 325 TLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYAQHTQVRAIRKKMCEIITRDVTN 504 TLIEA +DVKTTDGY+LR+FCIGFT + +KT YA+HTQ++AIRKKM +IITR+V+ Sbjct: 2 TLIEAAVDVKTTDGYLLRMFCIGFTKRRQNQIKKTAYAKHTQIKAIRKKMVDIITREVST 61 Query: 505 SDSGRW*TS*FPDSIAKDIEK 567 +D PDSI KDIEK Sbjct: 62 NDLKEVVNKLIPDSIGKDIEK 82 Score = 33.1 bits (72), Expect = 0.22 Identities = 24/51 (47%), Positives = 29/51 (56%) Frame = +3 Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662 L+EVVNKLI E + YPL DV KVKVLK+ F +I KL+ Sbjct: 64 LKEVVNKLIPD-SIGKDIEKSCQSIYPLHDVHIRKVKVLKKPKF-DIGKLM 112 >SB_22837| Best HMM Match : REJ (HMM E-Value=0.057) Length = 643 Score = 33.1 bits (72), Expect = 0.22 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 7/58 (12%) Frame = +3 Query: 180 IYKLTLTR-KGLSANSD*SPNMCKDVCALQLPRHGPH------NR*AQVDG*KMADSH 332 ++KLT+T KGL+ + + N+ KDV + R GP NR A++DG K +D H Sbjct: 306 VFKLTVTDDKGLTGSGTVAVNVKKDVNQAPVARAGPDVVVHLPNRAAELDGSKSSDDH 363 >SB_45038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 561 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/60 (26%), Positives = 26/60 (43%) Frame = -1 Query: 219 LRKDLSASVSACRSARETSKTLPFNPSEAIFVPWVRLTSVVPTCLLLNIDGALTSYQSLR 40 LRK L S + RE + L FNP E+ +V L + ++ + +SL+ Sbjct: 302 LRKQLIDMASVAKDLREIDELLKFNPDESAYVLQAESLKKANNVLQIELEELIKKEKSLK 361 >SB_21643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1974 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = +2 Query: 158 VFEVSLADLQADTDAERSFRKFRLIAEYVQ 247 +F + +D+QA+++ FR+F L+ EYV+ Sbjct: 1176 IFNNTFSDVQANSNQIWKFRRFELVMEYVE 1205 >SB_50701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 23 IVDPFTRKDWYDVKAPSMFSKRQ 91 +V+P+ KDW D SMFS RQ Sbjct: 98 LVEPWRWKDWEDFTQSSMFSGRQ 120 >SB_8499| Best HMM Match : DUF229 (HMM E-Value=0) Length = 926 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -1 Query: 339 GFDESLPFFNHPPELIGCEVHAVEVAEHIRPC 244 G + FN P+ GCE A VAEH PC Sbjct: 747 GLKRGMSMFNEIPKTRGCE--AAGVAEHYCPC 776 >SB_59024| Best HMM Match : 7tm_1 (HMM E-Value=5.2e-19) Length = 423 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Frame = +3 Query: 3 KKVLRRRLSTHSL---AKIGTMSRLRLCSARGKSAPRLSTV 116 KK+LRR+LS S + G SRLR C + + R+ +V Sbjct: 374 KKILRRQLSDSSFRSRSSSGFASRLRYCGSNQSESSRVQSV 414 >SB_46059| Best HMM Match : Astacin (HMM E-Value=2.8e-17) Length = 1775 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +2 Query: 206 RSFRKFRLIAEYVQGRMCSATSTAWTSQPISSGGWLKNGR 325 R++ K LI G + W P++ GW NGR Sbjct: 22 RTWHKAELIPPQWPGAQGQLRTVTWHGSPVTRNGWTWNGR 61 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,410,154 Number of Sequences: 59808 Number of extensions: 514723 Number of successful extensions: 1510 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1510 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -