BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30029 (530 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY748851-1|AAV28197.1| 98|Anopheles gambiae cytochrome P450 pr... 24 2.8 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 23 4.8 AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein ... 23 6.4 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 6.4 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 8.4 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 8.4 >AY748851-1|AAV28197.1| 98|Anopheles gambiae cytochrome P450 protein. Length = 98 Score = 24.2 bits (50), Expect = 2.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 319 FYDGIF*FCTLLCMCNYQLAI 381 F+ GI TLLC +Y+LA+ Sbjct: 23 FFGGIETTTTLLCFTSYELAV 43 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 23.4 bits (48), Expect = 4.8 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 268 VRYIRNTFTLVSRF*KNFYDGIF*FCTLLCMCNY 369 VRYI N+ F+DG FC L+C+ ++ Sbjct: 390 VRYIENSPKSAFTGRIEFWDGGRDFCFLICLFSF 423 >AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein protein. Length = 705 Score = 23.0 bits (47), Expect = 6.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 318 FL*RYFLILYTFVHVQLSIGH 380 FL L+L TFV V +S+GH Sbjct: 206 FLTITILLLATFVFVSVSMGH 226 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.0 bits (47), Expect = 6.4 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = +3 Query: 3 LISAPGGKRSKRSNSIQNRVNFYANESVKKTRTKRTV 113 L+SA K S NS+ AN R K+T+ Sbjct: 367 LVSAKESKESTLKNSLDKFAKVQANMRATNERRKKTL 403 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 8.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 277 IRNTFTLVSRF*KNFYDGIF*FCTL 351 I+ F+ S+F KN GI+ C L Sbjct: 748 IKQLFSAASKFQKNLKRGIYLACVL 772 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 22.6 bits (46), Expect = 8.4 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 332 FFNSVHFCACATINW 376 FFN+ + C +INW Sbjct: 119 FFNNYNLCHMKSINW 133 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 547,679 Number of Sequences: 2352 Number of extensions: 10329 Number of successful extensions: 21 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49051644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -