BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30026 (796 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24957| Best HMM Match : Terminase_4 (HMM E-Value=2.7) 29 5.7 SB_50854| Best HMM Match : ig (HMM E-Value=6.1e-27) 28 7.6 >SB_24957| Best HMM Match : Terminase_4 (HMM E-Value=2.7) Length = 354 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/68 (25%), Positives = 29/68 (42%) Frame = -3 Query: 593 FLTPTRSDKYVKTSVAGPPIMNPLMVLAAAEVCSLERCFGLKLSLHPGATSSLGCSSCRR 414 FL ++D Y+ T P P + E+ L + A+ S+GC+SC+R Sbjct: 251 FLNTPKNDDYIATEAT--PFTVPAVQHNEMEISKFSTVTATVLGVQK-ASRSIGCTSCQR 307 Query: 413 HRPLYPRR 390 + P + Sbjct: 308 QTVVTPNK 315 >SB_50854| Best HMM Match : ig (HMM E-Value=6.1e-27) Length = 770 Score = 28.3 bits (60), Expect = 7.6 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -1 Query: 742 PGKEQPPRSKLARALDSPGF*MESPSRRVQAKVTRPQQNS 623 P + PP + L RALD+ G P RR+ +TR Q++ Sbjct: 714 PKAKLPPNNSLFRALDASGPVSRGPDRRM-PDITRANQSA 752 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,639,089 Number of Sequences: 59808 Number of extensions: 646966 Number of successful extensions: 1571 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1450 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1569 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2191792647 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -