BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30025 (734 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP4H10.06c |cut14|smc2, smc2|condensin subunit Cut14|Schizosac... 27 2.1 SPAC1952.01 ||SPAC1B3.19|Pig-U|Schizosaccharomyces pombe|chr 1||... 25 8.5 >SPBP4H10.06c |cut14|smc2, smc2|condensin subunit Cut14|Schizosaccharomyces pombe|chr 2|||Manual Length = 1172 Score = 27.5 bits (58), Expect = 2.1 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +1 Query: 70 IKNHETWSLLNTLFHSMEV-YVESENNVQKCIEIIIVHNVMVGETNQEIVIKKFSFNTMK 246 ++ T SL+ T +E+ V E+N +K E+I + + N+EI S T + Sbjct: 842 VQGESTTSLIKTEIAELELSLVNEEHNRKKLTELIEIESAKFSGLNKEIDSLSTSMKTFE 901 Query: 247 S 249 S Sbjct: 902 S 902 >SPAC1952.01 ||SPAC1B3.19|Pig-U|Schizosaccharomyces pombe|chr 1|||Manual Length = 408 Score = 25.4 bits (53), Expect = 8.5 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = -1 Query: 488 IPGVIFFNSHEFLNFIPNKGKVRYVFFPIFN*YQNIFYYSNIIYKRCFII 339 IP ++ +SH+ PN G Y F +FN ++ F + I F++ Sbjct: 234 IPFRVYLDSHDLT---PNLGLWWYFFTEMFNEFRTFFLFVFAILPLMFVL 280 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,021,147 Number of Sequences: 5004 Number of extensions: 62719 Number of successful extensions: 137 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 137 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 347244562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -